This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf
Fortfahren mit
Größe auswählen
| Größe/SKU | Verfügbarkeit | Preis |
|---|---|---|
2 x 25 μg | Warenkorb auf Verfügbarkeit prüfen | € 322,00 |
Über diesen Artikel
form
lyophilized powder
analyte chemical class(es)
amino acids, peptides, proteins
technique(s)
HPLC: suitable, protein mass spectrometry: suitable
application(s)
food and beverages
format
multi-component solution
shipped in
ambient
storage temp.
2-8°C
General description
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
Application
- Wiederholbarkeit/Reproduzierbarkeit von Durchgängen
- Systemstabilität (Verschiebung, Chromatographie, Signalstärke, Sensitivität usw.)
- Inter- und Intra-Plattform- und -Laborvergleiche
Features and Benefits
Complexity
- Defined mixture gives confidence in your instruments analysis
Other Notes
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| description lyophilized powder | description Proteomics MRM LC-MS Calibration Standard | description analytical standard | description analytical standard |
| format multi-component solution | format - | format multi-component solution | format neat |
| form lyophilized powder | form solid | form solid | form - |
| technique(s) HPLC: suitable | technique(s) - | technique(s) HPLC: suitable | technique(s) HPLC: suitable, gas chromatography (GC): suitable |
| application(s) food and beverages | application(s) - | application(s) food and beverages | application(s) food and beverages |
| analyte chemical class(es) amino acids, peptides, proteins | analyte chemical class(es) - | analyte chemical class(es) amino acids, peptides, proteins | analyte chemical class(es) amino acids, peptides, proteins |
| shipped in ambient | shipped in - | shipped in - | shipped in - |
Was ist los?
WGK 1
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Lagerklasse
12 - Non Combustible Liquids
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
-
1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.
1 answer-
Helpful?
-



