MSST0060

SILu^™Lite CST3, Cystatin C human

recombinant, expressed in E. coli, MS Protein Standard

• Synonym(e): CST3, Cystatin C
• NACRES: NA.32
• UNSPSC Code: 23201100
• Form: lyophilized powder
• Assay: ≥95% (SDS-PAGE)
• Recombinant: expressed in E. coli

Eigenschaften

• recombinant: expressed in E. coli
• Quality Segment: 200
• assay: ≥95% (SDS-PAGE)
• form: lyophilized powder
• technique(s): protein mass spectrometry: suitable
• suitability: suitable for mass spectrometry (internal calibrator)
• UniProt accession no.: P01034 (aa 27-146)
• shipped in: ambient
• storage temp.: −20°C
• Gene Information: human ... CST3(1471)

Beschreibung

General description

SILu^™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu^™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biochem/physiol Actions

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Other Notes

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Sicherheitshinweise

• Lagerklasse: 11 - Combustible Solids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable