SAB1410166

Anti-NUDT5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(e): YSA1, YSA1H, hYSAH1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IF, WB
• Citations: 3

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 24.3 kDa
• species reactivity: human
• technique(s): immunofluorescence: suitable, western blot: 1 μg/mL
• NCBI accession no.: NM_014142.2
• UniProt accession no.: Q9UKK9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NUDT5(11164)

Beschreibung

General description

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM

Immunogen

NUDT5 (NP_054861.2, 1 a.a. ~ 219 a.a) full-length human protein.

Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Biochem/physiol Actions

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is mainly involved in maintaining the intracellular level of ADP-ribose by hydrolyzing ADP-ribose (ADPR) to AMP and ribose 5′-phosphate. It also restricts non-enzymatic ADP-ribosylation. Its N-terminal antiparallel β-sheet plays an important role in dimerization, which is essential for substrate recognition and enzymatic activity. NUDT5 has also been predicted for altered cell proliferation. It has been suggested that cells with suppressed NUDT5 shows delayed cell cycle G1 phase. Thus, it has been concluded that NUDT5 may involve in cell growth and cell cycle proliferation by regulating G1-S transition in mammalian cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Was ist los?: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable