SAB2103151

Anti-MYBL1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-A-MYB, Anti-AMYB, Anti-MGC120059, Anti-MGC120061
• NACRES: NA.41
• UNSPSC Code: 12352203
• eCl@ss: 32160702
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 82 kDa
• species reactivity: human, dog, pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_001080416
• UniProt accession no.: P10243
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MYBL1(4603)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human MYBL1

Biochem/physiol Actions

MYBL1 is a strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. MYBL1 could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: AFIQQPFIDEDPDKEKKIKELEMLLMSAENEVRRKRIPSQPGSFSSWSGS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable