Sélectionner une taille de conditionnement
519,00 €
519,00 €
A propos de cet article
Passer à
Nom du produit
Anti-ATRX antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... ATRX(546)
1 of 4
Cet article | HPA064684 | HPA000994 | SAB3501189 |
|---|---|---|---|
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form purified antibody (Ion exchange) |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line - |
| Gene Information human ... ATRX(546) | Gene Information human ... ATRX(546) | Gene Information human ... TXN2(25828) | Gene Information human ... ANTXR1(84168) |
Application
Le Human Protein Atlas peut être subdivisé en trois sous-projets : le Human Tissue Atlas pour les tissus humains, le Cancer Atlas pour les tissus cancéreux et le Human Cell Atlas pour les cellules humaines. Les anticorps produits dans le cadre des projets Human Tissue Atlas et Cancer Atlas ont été testés par immunohistochimie contre des centaines de tissus normaux et malades. Grâce aux derniers travaux menés dans le cadre du projet Human Cell Atlas, beaucoup d'anticorps ont été caractérisés par immunofluorescence afin de cartographier le protéome humain, non seulement au niveau des tissus, mais aussi des divers compartiments cellulaires. Ce vaste ensemble de données et les images correspondantes peuvent être consultés sur le site du Human Protein Atlas (HPA) en cliquant sur le lien Image Gallery (galerie d'images). Nous fournissons également les protocoles relatifs aux anticorps Prestige Antibodies® ainsi que d'autres informations pratiques. L'anticorps anti-ATRX produit chez le lapin a été utilisé en immunohistochimie.[1]
Disclaimer
Features and Benefits
Chaque anticorps Prestige Antibody est testé comme suit :
- Immunohistochimie sur puces à tissus avec 44 tissus humains normaux et 20 tissus des cancers les plus courants
- Puce à protéines avec 364 fragments de protéines recombinantes humaines
Immunogen
Séquence
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Other Notes
Physical form
Legal Information
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Classe de stockage
10 - Combustible liquids
wgk
WGK 1
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Faites votre choix parmi les versions les plus récentes :
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Articles
Antibodies combine with specific antigens to generate an exclusive antibody-antigen complex. Learn about the nature of this bond and its use as a molecular tag for research.
Learn differences in monoclonal vs polyclonal antibodies including how antibodies are generated, clone numbers, and antibody formats.
Lernen Sie die Grundlagen der Arbeit mit Antikörpern kennen und erhalten Sie technische Informationen über Struktur, Klassen und normale Immunglobulinbereiche.
Explore the basics of working with antibodies including technical information on structure, classes, and normal immunoglobulin ranges.
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique


