Accéder au contenu
Merck

HPA001906

Anti-ATRX Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Anti-ATRX antibody produced in rabbit

Synonyme(s) :

Anticorps anti-Znf-HX, Anticorps anti-hélicase ATRX dépendante de l’ATP, Anticorps anti-hélicase II liée à l’X, JMS, RAD54, XH2, XNP


Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

100 μL

519,00 €

519,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB001906


A propos de cet article

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

Passer à

Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider

Nom du produit

Anti-ATRX antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... ATRX(546)

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 4

Cet article
HPA064684HPA000994SAB3501189
antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

purified antibody (Ion exchange)

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

Gene Information

human ... ATRX(546)

Gene Information

human ... ATRX(546)

Gene Information

human ... TXN2(25828)

Gene Information

human ... ANTXR1(84168)

Application

Tous les anticorps Prestige d'Atlas Antibodies sont développés et validés par le projet Human Protein Atlas (HPA) et bénéficient ainsi de la caractérisation la plus poussée du secteur.

Le Human Protein Atlas peut être subdivisé en trois sous-projets : le Human Tissue Atlas pour les tissus humains, le Cancer Atlas pour les tissus cancéreux et le Human Cell Atlas pour les cellules humaines. Les anticorps produits dans le cadre des projets Human Tissue Atlas et Cancer Atlas ont été testés par immunohistochimie contre des centaines de tissus normaux et malades. Grâce aux derniers travaux menés dans le cadre du projet Human Cell Atlas, beaucoup d'anticorps ont été caractérisés par immunofluorescence afin de cartographier le protéome humain, non seulement au niveau des tissus, mais aussi des divers compartiments cellulaires. Ce vaste ensemble de données et les images correspondantes peuvent être consultés sur le site du Human Protein Atlas (HPA) en cliquant sur le lien Image Gallery (galerie d'images). Nous fournissons également les protocoles relatifs aux anticorps Prestige Antibodies® ainsi que d'autres informations pratiques. L'anticorps anti-ATRX produit chez le lapin a été utilisé en immunohistochimie.[1]

Disclaimer

Sauf indication contraire dans nos catalogues ou autre documentation de la Société accompagnant de(s) produit(s), nos produits sont conçus uniquement pour la recherche et ne peuvent pas être utilisés dans d′autres buts, ce qui inclut mais sans s′y limiter, les utilisations commerciales non autorisées, les utilisations de diagnostic in vitro, les usages thérapeutiques ex vivo ou in vivo et tout type de consommation par ou d′application à l′homme ou aux animaux.

Features and Benefits

Les anticorps Prestige Antibodies® sont très bien caractérisés et validés. De plus, toutes les données de caractérisation disponibles pour chaque cible sont consultables sur le portail The Human Protein Atlas accessible par le lien situé juste en dessous du nom du produit en haut de cette page. L'unicité et la faible réactivité croisée des anticorps Prestige Antibodies® avec les autres protéines résultent d'une sélection rigoureuse des régions antigéniques, d'une purification par affinité et d'une sélection selon des critères stricts. Il existe un antigène témoin Prestige pour chaque anticorps Prestige Antibody. Retrouvez-le dans la rubrique Liaison.

Chaque anticorps Prestige Antibody est testé comme suit :
  • Immunohistochimie sur puces à tissus avec 44 tissus humains normaux et 20 tissus des cancers les plus courants
  • Puce à protéines avec 364 fragments de protéines recombinantes humaines

Immunogen

Protéine recombinante correspondant au gène impliqué dans la thalassémie alpha liée à l′X avec retard mental.

Séquence
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR

Other Notes

Antigène correspondant : APREST74299

Physical form

Solution dans un tampon phosphate salin à pH 7,2 contenant 40 % de glycérol et 0,02 % d′azoture de sodium.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Classe de stockage

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Aida Kiviniemi et al.
Oncotarget, 8(30), 49123-49132 (2017-05-04)
Somatostatin receptor subtype 2A (SSTR2A) is a potential therapeutic target in gliomas. Data on SSTR2A expression in different glioma entities, however, is particularly conflicting. Our objective was to characterize SSTR2A status and explore its impact on survival in gliomas classified
Katharina I Deeg et al.
Frontiers in oncology, 6, 186-186 (2016-09-08)
Telomere maintenance is a hallmark of cancer as it provides cancer cells with cellular immortality. A significant fraction of tumors uses the alternative lengthening of telomeres (ALT) pathway to elongate their telomeres and to gain an unlimited proliferation potential. Since
Yavuz Oktay et al.
Scientific reports, 6, 27569-27569 (2016-06-11)
The single nucleotide polymorphism rs55705857, located in a non-coding but evolutionarily conserved region at 8q24.21, is strongly associated with IDH-mutant glioma development and was suggested to be a causal variant. However, the molecular mechanism underlying this association has remained unknown.
Gerald F Reis et al.
Journal of neuropathology and experimental neurology, 74(5), 442-452 (2015-04-09)
Lower-grade (World Health Organization Grades II and III) gliomas vary widely in clinical behavior and are classified as astrocytic, oligodendroglial, or mixed. Anaplasia depends greatly on mitotic activity, with CDKN2A loss considered as the most common mechanism for cell cycle
David Valle-García et al.
Epigenetics, 11(6), 398-414 (2016-04-01)
ATRX is a SWI/SNF chromatin remodeler proposed to govern genomic stability through the regulation of repetitive sequences, such as rDNA, retrotransposons, and pericentromeric and telomeric repeats. However, few direct ATRX target genes have been identified and high-throughput genomic approaches are

Articles

Antibodies combine with specific antigens to generate an exclusive antibody-antigen complex. Learn about the nature of this bond and its use as a molecular tag for research.

Learn differences in monoclonal vs polyclonal antibodies including how antibodies are generated, clone numbers, and antibody formats.

Lernen Sie die Grundlagen der Arbeit mit Antikörpern kennen und erhalten Sie technische Informationen über Struktur, Klassen und normale Immunglobulinbereiche.

Explore the basics of working with antibodies including technical information on structure, classes, and normal immunoglobulin ranges.

Questions

Reviews

Active Filters

  1. 1 Ratings-only review

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique