AV13107

Anti-RAB14 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-RAB14, member RAS oncogene family
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 3

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 24 kDa
• species reactivity: rat, goat, human, pig, bovine, mouse, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_057406
• UniProt accession no.: P61106
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RAB14(51552)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human RAB14

Application

Anti-RAB14 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

RAB14 is a member of Rab GTPases that regulate the roles and identity of endosomes. Rab14 collaborates with FAM116 in regulating proteolytic cleavage of N-cadherin, and modulation of cell-cell adhesion and cell motility. Rab14 mediates the endocytic transport of GLUT4 from cytoplasmic compartments to cell surface.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable