AV34772

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Ubiquitin-like, containing PHD and Ring finger domains, 2
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 2

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 90 kDa
• species reactivity: rabbit, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_690856
• UniProt accession no.: Q96PU4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... UHRF2(115426)

Opis

General description

UHRF2 is a ubiquitin E3 ligase that also functions as a SUMO E3 ligase for ZNF131. This E3 ligase has been implicated in the cell cycle network.
Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human UHRF2

Application

Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml and for IHC (4-8 μg/ml).

Biochem/physiol Actions

UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable