AV43519

Anti-M6PR antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-CD-MPR, Anti-FLJ32994, Anti-MPR46, Anti-Mannose-6-phosphate receptor (cation dependent), Anti-SMPR
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 5

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 28 kDa
• species reactivity: mouse, human, rabbit, guinea pig, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_002346
• UniProt accession no.: P20645
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... M6PR(4074)

Opis

General description

Mannose-6-phosphate receptor (cation dependent) (M6PR) is a receptor for mannose-6-phosphate groups on lysosomal enzymes. It is an integral membrane protein that belongs to type I membrane-spanning glycoproteins. M6PR protein exists as a homodimer and localizes in the trans-Golgi reticulum, endosomes, and the plasma membrane. M6PR gene is mapped to human chromosome 12p13.31.

Immunogen

Synthetic peptide directed towards the N terminal region of human M6PR

Biochem/physiol Actions

Mannose-6-phosphate receptor (cation dependent) (M6PR) aids in intracellular targeting of lysosomal enzymes. It mediates the export of newly synthesized acid hydrolases from the trans-Golgi network (TGN) to endosomes for their subsequent transfer to lysosomes. The presence of a cytoplasmic tail in M6PR protects it from lysosomal degradation. in vitro studies suggest that M6PR favors the secretion of pro-cathepsin D in breast cancer cells.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable