AV54299

Anti-GSN antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-DKFZp313L0718, Anti-Gelsolin (aMyloidosis, Finnish type)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 3

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 83 kDa
• species reactivity: bovine, sheep, horse, guinea pig, human, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_001121134
• UniProt accession no.: P06396
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GSN(2934)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human GSN

Application

Anti-GSN antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

GSN gene encodes a 93,000-dalton actin-modulating protein localized in the cytoplasm of cells. It plays a pivotal role in regulating actin filament length as well as prevents monomer exchange by blocking or capping the "plus" ends of actin monomers and filaments. Defects in GSN gene leads to familial amyloidosis Finnish type (FAF).

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable