SAB1401363

Monoclonal Anti-SLC6A11 antibody produced in mouse

clone 2C3, purified immunoglobulin, buffered aqueous solution

• Synonim(y): GAT-3, GAT3
• NACRES: NA.41
• UNSPSC Code: 12352203

Właściwości

• Nazwa produktu: Monoclonal Anti-SLC6A11 antibody produced in mouse, clone 2C3, purified immunoglobulin, buffered aqueous solution
• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2C3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_014229
• UniProt accession no.: P48066
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... SLC6A11(6538)

Opis

General description

Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11.[supplied by OMIM

Immunogen

SLC6A11 (NP_055044.1, 164 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR

Physical form

Solution in phosphate buffered saline, pH 7.4

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable