Przejdź do
Wybierz wielkość
| Rozmiar/SKU | Dostępność | Cena netto |
|---|---|---|
100 μg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2300,00 zł |
Informacje o tej pozycji
2300,00 zł
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
antigen 39.3 kDa
species reactivity
human
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CXCR6(10663)
Immunogen
Sequence
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Physical form
1 of 1
Ta pozycja | |||
|---|---|---|---|
| description purified immunoglobulin, buffered aqueous solution | description affinity isolated antibody, buffered aqueous solution | description IgG fraction of antiserum, buffered aqueous solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution |
| Quality Level 100 | Quality Level 200 | Quality Level 100 | Quality Level 100 |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form IgG fraction of antiserum | antibody form affinity isolated antibody |
| species reactivity human | species reactivity human | species reactivity mouse, human | species reactivity human |
| technique(s) western blot: 1 μg/mL | technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 5 μg/mL using human lymph node, B-cell lymphoma | technique(s) immunocytochemistry: suitable, immunoprecipitation (IP): suitable, indirect ELISA: suitable, flow cytometry: suitable, western blot: suitable, immunofluorescence: suitable | technique(s) immunohistochemistry: 1:1000- 1:2500 |
Still not finding the right product?
Explore all of our products under Anti-CXCR6 antibody produced in rabbit
— lub —
Wypróbuj nasze narzędzie Narzędzie selektora produktów, aby zawęzić opcje.
Klasa składowania
10 - Combustible liquids
Co się dzieje?
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.



