Iniciar sesión para ver los precios por organización y contrato.
Seleccione un Tamaño
Cambiar Vistas
Acerca de este artículo
UNSPSC Code:
12352202
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarlerecombinant
expressed in E. coli
assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 24 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... GRB2(2885)
General description
Recombinant protein fragment of Human GRB2 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Blocking agent and positive assay control using corresponding antibodies.
Physical form
Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA030749.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Clase de almacenamiento
10 - Combustible liquids
¿Qué está pasando?
WGK 2
Punto de inflamación (°F)
Not applicable
Punto de inflamación (°C)
Not applicable
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.