The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
https://www.uniprot.org/uniprotkb/P01133/entry
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Fortfahren mit
E9644
Epidermal Growth Factor, human
≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Synonym(e):
Epidermaler Wachstumsfaktor human, EGF
Anmelden zur Ansicht der Organisations- und Vertragspreise.
Größe auswählen
Ansicht ändern
| Größe/SKU | Verfügbarkeit | Preis |
|---|---|---|
0.2 mg | Warenkorb auf Verfügbarkeit prüfen | € 332,00 |
0.5 mg | Warenkorb auf Verfügbarkeit prüfen | € 482,00 |
5 x 0.2 mg | Warenkorb auf Verfügbarkeit prüfen | € 788,00 |
Über diesen Artikel
Biological source:
human
Recombinant:
expressed in E. coli
Assay:
≥97% (SDS-PAGE)
Form:
lyophilized powder
Mol wt:
~6 kDa
Impurities:
≤1 EU/μg endotoxin (EGF)
€ 332,00
Warenkorb auf Verfügbarkeit prüfen
Technischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhaltenProduktname
hEGF, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
biological source
human
Quality Segment
recombinant
expressed in E. coli
assay
≥97% (SDS-PAGE)
form
lyophilized powder
potency
0.08-0.8 ng/mL ED50/EC50
mol wt
~6 kDa
packaging
pkg of 5X0.2 mg, pkg of 0.2 mg, pkg of 0.5 mg
storage condition
avoid repeated freeze/thaw cycles
technique(s)
cell culture | mammalian: suitable
impurities
≤1 EU/μg endotoxin (EGF)
color
white
solubility
water: soluble, clear, colorless
UniProt accession no.
storage temp.
−20°C
SMILES string
S(CC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]%12N(CCC%12)C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N
InChI
1S/C270H401N73O83S7/c1-24-134(19)217(262(420)293-112-201(355)298-161(69-74-205(359)360)229(387)301-160(45-35-82-286-269(279)280)228(386)333-192(119-428)255(413)307-162(68-73-198(274)352)230(388)316-176(94-141-54-64-150(350)65-55-141)241(399)304-159(44-34-
InChI key
GVUGOAYIVIDWIO-UFWWTJHBSA-N
Gene Information
human ... EGF(1950)
Application
Biochem/physiol Actions
Der epidermale Wachstumsfaktor (EGF) ist ein kleines mitogenes Polypeptid, das in vielen verschiedenen Gewebeteilen und Körperflüssigkeiten mehrerer Säugetierarten vorhanden ist. EGF ist ein Mitglied der Wachstumsfaktorfamilie, die durch sechs konservierte Cysteinmotive charakterisiert ist, die drei Disulfidbindungen bilden. EGF ist für eine Vielzahl verschiedener Epidermis- und Epithelzellen mitogen, u. a. Fibroblasten, Gliazellen, vaskuläre und korneale Endothelzellen, Rinder-Granulosazellen, HeLa-Zellen, SV40-3T3-Zellen und Säuger-Epithelzellen.
Von EGF betroffene Zellfunktionen: Mitose, Ionenfluss, Glucosetransport, Glycolyse, Nukleinsäure- und Proteinsynthese, Überleben, Wachstum, Proliferation und Differenzierung.
Biologische Wirkungen von EGF: Hemmung der Magensäure-Sekretion, Fötuswachstum und -entwicklung und Neuromodulation im zentralen Nervensystem.
Von EGF betroffenen Signalwege: EGFR-Signale, MAPK-Kaskaden, PIP, Ca+2-Signale
Von EGF betroffene Zellfunktionen: Mitose, Ionenfluss, Glucosetransport, Glycolyse, Nukleinsäure- und Proteinsynthese, Überleben, Wachstum, Proliferation und Differenzierung.
Biologische Wirkungen von EGF: Hemmung der Magensäure-Sekretion, Fötuswachstum und -entwicklung und Neuromodulation im zentralen Nervensystem.
Von EGF betroffenen Signalwege: EGFR-Signale, MAPK-Kaskaden, PIP, Ca+2-Signale
Preparation Note
Dieses Produkt wurde aus einer 0,2 μM-filtrierten Lösung aus phosphatgepufferter Kochsalzlösung, pH 7,4, lyophilisiert. Es sollte durch Zugabe des Inhalts des Fläschchens auf 1 mg/ml unter Verwendung von 10 mM Essigsäure rekonstituiert werden. Zur Verdünnung auf niedrigere Konzentrationen, jedoch nicht unter 10 μg/ml, ist die Zugabe von 0,1 % BSA oder HSA erforderlich. Zur Verwendung in Proliferationsassays die Probe mit Medium ohne Albumin weiter verdünnen.
Analysis Note
Die biologische Aktivität dieses Produkts wird mit einem Zellproliferationsassay unter Verwendung von BALB/MK-Zellen gemessen. EC50 wird als die effektive Konzentration des Wachstumsfaktors definiert, die in einem zellbasierten Bioassay einen Anstieg des Zellwachstums von 50 % hervorruft.
Other Notes
Humanes EGF (hEGF) ist mit β-Urogastron identisch, einem auf der Grundlage seiner Fähigkeit zur Hemmung der Magensäure-Sekretion isolierten Molekül. EGF ist strukturell mit dem humanen transformierenden Wachstumsfaktor α homolog. Beide wirken über EGF-Rezeptoren. E9644 ist die N-terminale Methionyl-Form des natürlichen reifen EGF.
Disclaimer
Das Produkt sollte bei -20 °C gelagert werden und bleibt mindestens 3 Jahre lang aktiv. Nach der Rekonstitution kann es einen Monat lang bei 2–8 °C oder für längere Zeit in Aliquoten gefroren bei -70 °C oder -20 °C aufbewahrt werden.
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| description EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture | description EGF, recombinant, expressed in Escherichia coli, >97% (SDS-PAGE) | description EGF, suitable for cell culture | description HGF, recombinant, expressed in NSO cells, suitable for cell culture |
| biological source human | biological source human | biological source mouse submaxillary glands | biological source human |
| assay ≥97% (SDS-PAGE) | assay >97% (SDS-PAGE) | assay - | assay ≥95% (SDS-PAGE) |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant - | recombinant expressed in NSO cells |
| technique(s) cell culture | mammalian: suitable | technique(s) - | technique(s) cell culture | mammalian: suitable | technique(s) cell culture | mammalian: suitable |
| Quality Level 300 | Quality Level 200 | Quality Level 200 | Quality Level 200 |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized powder |
Lagerklasse
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
-
what is the full peptide sequence of mature E9644 protein (~6kD)?
1 answer-
Helpful?
-
-
For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?
1 answer-
After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.
Helpful?
-
-
Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
We recommend reconstitution with acetic acid to make sure the entire product will be solubilized. PBS can be used, but the total amount of the protein in the vial may not go into solution. It is best to make a higher concentration in acetic acid, and then dilute into PBS.
Helpful?
-
-
What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?
1 answer-
Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.
Helpful?
-
-
Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?
1 answer-
This product has been tested for activity using the mouse Balb/3T3 cell line. We have not tested its activity in rat cell culture, but we expect that will also work in that application.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
The mature protein has a molecular weight of 6 kD.
Helpful?
-
-
How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.
Helpful?
-