Passa al contenuto
Merck

C8490

CRG-2 from mouse

BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture

Sinonimo/i:

CXCL10, Cytokine Responsive Gene 2, IP-10

Autenticati per visualizzare i prezzi organizzativi e contrattuali.

Scegli un formato

Cambia visualizzazione

Informazioni su questo articolo

UNSPSC Code:
12352209
NACRES:
NA.75
MDL number:
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutarti


recombinant

expressed in E. coli

product line

BioReagent

assay

≥97% (SDS-PAGE)

form

lyophilized powder

mol wt

predicted mol wt ~8.8 kDa

technique(s)

cell culture | mammalian: suitable

impurities

endotoxin, tested

UniProt accession no.

storage temp.

−20°C

Gene Information

mouse ... Cxcl10(15945)

General description

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.

Physical form

Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine

Analysis Note

The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.


Classe di stoccaggio

11 - Combustible Solids

Che succede?

WGK 3

Punto di infiammabilità (°F)

Not applicable

Punto di infiammabilità (°C)

Not applicable

DPI (dispositivi di protezione individuale)

Eyeshields, Gloves, type N95 (US)



Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti