HPA007575

Anti-S100A6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Calcyclin antibody produced in rabbit, Anti-Growth factor-inducible protein 2A9 antibody produced in rabbit, Anti-MLN 4 antibody produced in rabbit, Anti-PRA antibody produced in rabbit, Anti-Prolactin receptor-associated protein antibody produced in rabbit, Anti-Protein S100-A6 antibody produced in rabbit, Anti-S100 calcium-binding protein A6 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA007575
• NACRES: NA.41
• MDL number: MFCD00677384

속성

• 제품 이름: Anti-S100A6 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: rat, mouse, human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• immunogen sequence: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
• UniProt accession no.: P06703
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... S100A6(6277)

설명

Application

Anti-S100A6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

S100A6 (S100 calcium binding protein A6) protein functions in processes such as cell proliferation and differentiation, calcium homeostasis, and neuronal degeneration in the brain. It may act as a buffering protein similar to calbindin. It may function in ubiquitinylated proteolytic degradation and cytoskeletal dynamics. Inhibition of this protein results in a decrease in the production of new astrocytes. S100A6 is involved in the differentiation and maturation of astrocytes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

General description

S100A6 (S100 calcium binding protein A6) gene encodes an EF-hand calcium binding protein that is a member of the S100 family of proteins. It is also called calcyclin and contains a hydrophobic hinge region that connects the EF-hands. It is expressed in lineage restricted astrocyte precursors and may be useful in analyzing the characteristics of astrocyte precursors. It is also expressed in neural stem cells.

Immunogen

Protein S100-A6 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST70728

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• 저장 등급: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)