콘텐츠로 건너뛰기
Merck

HPA026749

Anti-ASPSCR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, Anti-Alveolar soft part sarcoma locus, Anti-Renal papillary cell carcinoma protein 17, Anti-Tether containing UBX domain for GLUT4, Anti-UBX domain-containing protein 9


조직 및 계약 가격을 보려면 로그인를 클릭합니다.

크기 선택

100 μL

₩942,834

₩942,834


구입 가능 여부는 고객센터에 문의하십시오.


제품정보 (DICE 배송 시 비용 별도)

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:

다음으로 건너뛰기

기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의

제품 이름

Anti-ASPSCR1 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... ASPSCR1(79058)

유사한 품목 비교

전체 비교 보기

차이점 표시

1 of 4

이 품목
HPA023548HPA020461HPA015142
biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Chromosomal alteration at der(17)t(X:17)(p11:q25) leads to the fusion of alveolar soft part sarcoma chromosomal region candidate gene 1 (ASPSCR1) and transcription factor E3 (TFE3) to form the complex ASPSCR1–TFE3 in paraffin-embedded alveolar soft part sarcomas (ASPS).This fusion transcript plays a vital role in differential diagnosis of ASPS. TFE3 forms a complex with ASPL by replacing its N-terminal portion with fused ASPL sequences, but TFE3 retains its DNA-binding domain facilitating transcriptional deregulation in the pathogenesis of ASPS. The protein encoded by ASPSCR1 consists of conserved domains and it might be involved in the ubiquitylation pathway,but specific function of this protein remains unknown. In 3T3-L1 (cell line derived from mouse 3T3 cells) adipocytes, ASPSCR1 controls the trafficking of glucose transporter type 4 (GLUT 4). The encoded protein initiates p97 hexamer disassembly and it is also involved in the reformation of Golgi complex after brefeldin A (BFA) removal.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

Alveolar soft part sarcoma chromosomal region candidate 1 (ASPSCR1) gene is mapped to human chromosome 17q25. ASPSCR1, also known as alveolar soft part sarcoma locus (ASPL) or TUG (tether, containing a UBX domain, for GLUT4) codes for a member of UBX – domain containing proteins. The encoded protein consist of 553 amino acids and it is characterized with a C-terminal ubiquitin regulatory X (UBX)-like domain. ASPSCR1 is ubiquitously expressed in all adult tissues.

Immunogen

Tether containing UBX domain for GLUT4 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST74813

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

저장 등급

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Technique for differentiating alveolar soft part sarcoma from other tumors in paraffin-embedded tissue: comparison of immunohistochemistry for TFE3 and CD147 and of reverse transcription polymerase chain reaction for ASPSCR1-TFE3 fusion transcript.
Tsuji K
Human Pathology, 43(3), 356-363 (2012)
The ubiquitin regulatory X (UBX) domain-containing protein TUG regulates the p97 ATPase and resides at the endoplasmic reticulum-golgi intermediate compartment.
Orme CM, Bogan JS
The Journal of Biological Chemistry, 287(9), 6679-6692 (2012)
Detection of the ASPSCR1-TFE3 gene fusion in paraffin-embedded alveolar soft part sarcomas.
Aulmann S
Histopathology, 50(7), 881-886 (2007)
The der(17)t(X;17)(p11;q25) of human alveolar soft part sarcoma fuses the TFE3 transcription factor gene to ASPL, a novel gene at 17q25.
Ladanyi M
Oncogene, 20(1), 48-57 (2001)
Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas.
Heimann P
Cancer Research, 61(10), 4130-4135 (2001)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.