콘텐츠로 건너뛰기
Merck

SAB1401130

Anti-FABP5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

동의어(들):

E-FABP, EFABP, PA-FABP, PAFABP

로그인 조직 및 계약 가격 보기

크기 선택

가격 및 재고 정보를 현재 이용할 수 없음 고객지원팀으로 연락바랍니다.

제품정보 (DICE 배송 시 비용 별도)

UNSPSC 코드:
12352203
NACRES:
NA.41

다음으로 건너뛰기

기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

종 반응성

mouse, human

기술

western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... FABP5(2171)

일반 설명

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. (provided by RefSeq)

면역원

FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

생화학적/생리학적 작용

FABPs (fatty acid-binding proteins) bind saturated and unsaturated long-chain fatty acids reversibly and might be involved in the transport of lipids to specific cellular compartments. FABP5 (fatty acid binding protein 5) serves as a transporter for endocannabinoid. FABP5 is also known as epidermal FABP (E-FABP) or mal1. FABP5 is significantly associated with the development of insulin resistance and atherosclerosis. This gene was found to be overexpressed in cervical cancer and it serves as an important biomarker for cervical cancer. In vitro study proves that FABP5 is necessary for cell proliferation, colony formation, cell migration, and invasion of cervical cancer. FABP5 is associated with cancer types such as bladder, pancreas, prostate, breast cancer and glioblastoma.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

FABP5 correlates with poor prognosis and promotes tumor cell growth and metastasis in cervical cancer.
Wang W
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 37(11), 14873-14883 (2016)
Fatty acid activated PPAR? promotes tumorigenicity of prostate cancer cells by up regulating VEGF via PPAR responsive elements of the promoter.
Forootan FS
Oncotarget, 7(8), 9322-9339 (2016)
The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
Hsu HC
Biochemistry, 56(27), 3454-3462 (2017)
Transcriptome and Metabolome Analyses in Exogenous FABP4- and FABP5-Treated Adipose-Derived Stem Cells.
Yamamoto T
PLoS ONE, 11(12), 1-19 (2016)
Takuro Iwao et al.
PloS one, 18(2), e0281946-e0281946 (2023-02-17)
Nutrients are actively taken up by the brain via various transporters at the blood-brain barrier (BBB). A lack of specific nutrients in the aged brain, including decreased levels of docosahexaenoic acid (DHA), is associated with memory and cognitive dysfunction. To

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.