This product is dialyzed in water before lyophilization and contains no buffers, salts or additives. The material is soluble in water at 1 mg/mL. For assay purposes, the product is reconstituted at 1 mg/mL in 0.85% NaCl.
Przejdź do
C4874
Calmodulin bovine
recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)
Synonim(y):
CaM, Phosphodiesterase 3:5-cyclic nucleotide activator, Phosphodiesterase 3′:5′-cyclic nucleotide activator
Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.
Wybierz wielkość
Zmień widok
| Rozmiar/SKU | Dostępność | Cena netto |
|---|---|---|
0.2 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 478,00 zł |
0.5 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 823,00 zł |
1 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 1540,00 zł |
2 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2830,00 zł |
Informacje o tej pozycji
Form:
lyophilized powder
Assay:
≥98% (SDS-PAGE)
Biological source:
bovine
Recombinant:
expressed in E. coli
Mol wt:
Mw 19000.9 by amino acid sequence
478,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomócbiological source
bovine
Quality Segment
recombinant
expressed in E. coli
assay
≥98% (SDS-PAGE)
form
lyophilized powder
mol wt
Mw 19000.9 by amino acid sequence
composition
Protein, ≥85%
UniProt accession no.
storage temp.
−20°C
Gene Information
bovine ... CALM(100297344)
General description
Sequence:
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Calmodulin from bovine takes up a dumb-bell-structure. Two calcium binding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.
Application
Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.
Biochem/physiol Actions
Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.
Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.
Preparation Note
Produced using animal component-free materials.
Ta strona może zawierać tekst przetłumaczony maszynowo.
1 of 1
Ta pozycja | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE) | description BioUltra, ≥98% (SDS-PAGE), lyophilized powder, essentially salt free | description lyophilized powder, 2,500-10,000 units/mg protein | description Calmodulin is a ubiquitous Ca2+-binding protein that serves as a physiological effector of a wide range of biological processes. Purified from bovine brain. |
| biological source bovine | biological source bovine testis | biological source bovine heart | biological source bovine brain |
| recombinant expressed in E. coli | recombinant - | recombinant - | recombinant - |
| assay ≥98% (SDS-PAGE) | assay ≥98% (SDS-PAGE) | assay - | assay ≥95% (SDS-PAGE) |
| mol wt Mw 19000.9 by amino acid sequence | mol wt 16.79 kDa | mol wt - | mol wt - |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. - |
Klasa składowania
11 - Combustible Solids
Co się dzieje?
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
-
How was the protein lyophilized? What was the buffer, it's concentration and volume?
1 answer-
Helpful?
-