APREST93046

PrEST Antigen DUSP2

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinônimo(s): PAC-1
• UNSPSC Code: 12352202

Propriedades

• recombinant: expressed in E. coli
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 23 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• immunogen sequence: GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPV
• Ensembl | human accession no.: ENSG00000158050
• UniProt accession no.: Q05923
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... DUSP2(1844)

Descrição

General description

Recombinant protein fragment of Human DUSP2 with N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Other Notes

Corresponding Antibody HPA071920.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Classe de armazenamento: 10 - Combustible liquids
• O que está acontecendo?: WGK 2
• Ponto de inflamação (°F): Not applicable
• Ponto de inflamação (°C): Not applicable