This product is a lyophilized powder. The purity and protein content per vial is reported on the lot specific Certificate of Analysis. Please see the link below to review the product datasheet which includes preparation instructions: https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/146/652/msqc19dat.pdf. Please see the link below to review a sample Certificate of Analysis: https://www.sigmaaldrich.com/certificates/COFA/MS/MSQC19/MSQC19-100UG______SLCD2802__.pdf
MSQC19
SILu™MAb Cetuximab Stable-Isotope Labeled Monoclonal Antibody
recombinant, expressed in CHO cells
Faça login para ver os preços organizacionais e de contrato.
Selecione um tamanho
Alterar visualização
| Tamanho/SKU | Disponibilidade | Preço |
|---|---|---|
100 μg | Verificar disponibilidade no carrinho | R$ 3.190,00 |
Sobre este item
NACRES:
NA.41
UNSPSC Code:
41105331
Technique(s):
protein mass spectrometry: suitable
Species reactivity:
-
Application:
protein mass spectrometry
Citations:
-
Assistência Técnica
Precisa de ajuda? Nossa equipe de cientistas experientes está à sua disposição.
Estamos aqui para ajudarrecombinant
expressed in CHO cells
assay
≥90% (SDS-PAGE)
form
solid
technique(s)
protein mass spectrometry: suitable
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
General description
SILu™MAb Cetuximab (MSQC19) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Cetuximab in human serum.
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Other Notes
SILu™MAb Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
1 of 1
Este Item | |||
|---|---|---|---|
| description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| form solid | form solid | form solid | form solid |
| assay ≥90% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥90% (HPLC) | assay ≥90% (SDS-PAGE) |
| suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability - |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
Classe de armazenamento
11 - Combustible Solids
O que está acontecendo?
WGK 3
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
-
What is the concentration and solubility of this product?
1 answer-
Helpful?
-