OGS2907

PSF-OXB20-COOH-TEV-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG BACTERIAL PLASMID

plasmid vector for molecular cloning

• 別名: cloning vector, expression vector, molecular cloning vector, plasmid, plasmid vector, snapfast vector, vector
• NACRES: NA.85
• UNSPSC Code: 12352200
• Promoter: Promoter name: OXB20; Promoter activity: constitutive; Promoter type: bacterial
• Origin of replication: pUC (500 copies)
• Bacteria selection: kanamycin
• Reporter gene: none
• Peptide cleavage: TEV

特性

• recombinant: expressed in E. coli
• tag: 6-His tagged, maltose-binding protein (MBP) tagged
• form: buffered aqueous solution
• mol wt: size 4997 bp
• bacteria selection: kanamycin
• origin of replication: pUC (500 copies)
• peptide cleavage: TEV
• peptide tag location: C-terminal
• promoter: Promoter name: OXB20; Promoter activity: constitutive; Promoter type: bacterial
• reporter gene: none
• shipped in: ambient
• storage temp.: −20°C

詳細

General description

This plasmid is designed to express tagged proteins in E. coli. The plasmid contains a constitutive promoter (OXB20) derived from the region upstream of the E. coli RecA gene. It does not require induction or any additional components for activity. It is the strongest of the bacterial promoters that we provide and this high level of expression can cause expression problems with some proteins with poor solubility. For this reason we sell a range of bacterial promoters with different expression levels (OXB1(low)>OXB20(high)) that can be provided with the peptide tags in this plasmid on request.

About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.

About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.

Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxfordgenetics.com.

Other Notes

Quick-reference Plasmid Map

Looking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics^™. Find out more at Oxford Genetics - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.

Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.

Genebank Vector Sequence File

FASTA Vector Sequence File

Full Plasmid Map

Legal Information

Oxford Genetics is a trademark of Oxford Genetics Ltd

安全性情報

• 保管分類: 12 - Non Combustible Liquids
• 引火点 (F): Not applicable
• 引火点（°C）: Not applicable