AV49592

Anti-CACHD1 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Cache domain containing 1, Anti-KIAA1573, Anti-RP4-655E10.1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 4

Properties

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 137 kDa
• species reactivity: mouse, horse, human, dog, guinea pig, rabbit, bovine, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_065976
• UniProt accession no.: Q5VU97
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CACHD1(57685)

Description

General description

The gene CAHD1 (Cache domain-containing protein 1) is mapped to human chromosome 1p31.3.

Immunogen

Synthetic peptide directed towards the N terminal region of human CACHD1

Application

Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

CACHD1 (Cache domain-containing protein 1) is a calcium channel protein that is important for excitation-contraction coupling. It is differentially regulated in humans suffering from parkinson disease. CACHD1 is up-regulated in human embryonic stem cells and is down-modulated upon differentiation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable