Key Documents

View All Documentation

Anti-ARNT2 antibody produced in rabbit

Name: Anti-ARNT2 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARNT protein 2, Anti-Aryl hydrocarbon receptor nuclear translocator 2

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

MDL number:

MFCD01633488

Human Protein Atlas Number:

HPA001056

Conjugate:

unconjugated

Clone:

polyclonal

Application:

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: suitable

immunogen sequence

GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS

UniProt accession no.

Q9HBZ2

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARNT2(9915)

Description

Immunogen

Aryl hydrocarbon receptor nuclear translocator 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Aryl hydrocarbon receptor nuclear translocator 2 is a protein encoded by the ARNT2 gene in humans. It plays an essential role in the development of the hypothalamo-pituitary axis, post-natal brain growth and visual and renal function in humans. The gene is associated with the prognosis of breast cancer and may play an important role in the modulation of hypoxia-inducible factor (HIF)-1-regulated signaling and metabolism.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST76153

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	SAB1403041	SAB2100154	SAB2100078
Sigma-Aldrich HPA001056 Anti-ARNT2 antibody produced in rabbit	Sigma-Aldrich SAB1403041 Monoclonal Anti-ARNT2 antibody produced in mouse	Sigma-Aldrich SAB2100154 Anti-ARNTL2 antibody produced in rabbit	Sigma-Aldrich SAB2100078 Anti-AHRR antibody produced in rabbit
description affinity isolated antibody, buffered aqueous glycerol solution	description clone 1B2, purified immunoglobulin, buffered aqueous solution	description affinity isolated antibody	description affinity isolated antibody
antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source mouse	biological source rabbit	biological source rabbit
UniProt accession no. Q9HBZ2	UniProt accession no. Q9HBZ2	UniProt accession no. Q8WYA1	UniProt accession no. A9YTQ3
clone polyclonal	clone 1B2, monoclonal	clone polyclonal	clone polyclonal

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.