HPA001085

ANTI-SASH3 antibody produced in rabbit

Name: ANTI-SASH3 antibody produced in rabbit
Brand: SIGMA
Price: 572 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-CXorf9, Anti-SASH3, Anti-SH3 protein expressed in lymphocytes homolog

Slide 1 of 5

Autenticati per visualizzare i prezzi organizzativi e contrattuali.

Scegli un formato

100 μL

CHF 572.00

Per conoscere la disponibilità, visualizza il carrello

Informazioni su questo articolo

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA001085

Documenti fondamentali

Visualizza tutta la documentazione

Vai a

Servizio Tecnico

Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.

Permettici di aiutarti

Nome del prodotto

ANTI-SASH3 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL

UniProt accession no.

O75995

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Confronta articoli simili

Visualizza il confronto per intero

Mostra le differenze

1 of 4

Questo articolo	HPA001603	HPA051600	HPA028464
Sigma-Aldrich HPA001085 ANTI-SASH3 antibody produced in rabbit	Sigma-Aldrich HPA001603 Anti-FAM181A antibody produced in rabbit	Sigma-Aldrich HPA051600 Anti-SPACA9 antibody produced in rabbit	Sigma-Aldrich HPA028464 Anti-HENMT1 antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunohistochemistry: 1:200-1:500	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:200-1:500	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

The sly gene is located on the X-chromosome in close proximity to genes involved in various immune disorders. This is consistent with an additional role of SLY in immune pathology.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Immunogen

SAM and SH3 domain-containing protein 3 homolog recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST74074

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?

Prova il nostro Motore di ricerca dei prodotti.

Classe di stoccaggio

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

R00218

R000218

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Silibinin attenuates Streptococcus suis serotype 2 virulence by targeting suilysin.

X Shen et al.

Journal of applied microbiology, 126(2), 435-442 (2018-11-09)

To determine the antivirulence properties of silibinin against suilysin (SLY), a virulence factor of Streptococcus suis serotype 2 (SS2) that plays an important role in the pathogenesis of S. suis infection and its protective effect against SS2 infection in a

Molecular cloning and characterization of a novel SH3 protein (SLY) preferentially expressed in lymphoid cells.

S Beer et al.

Biochimica et biophysica acta, 1520(1), 89-93 (2001-07-27)

A novel full-length cDNA was isolated from a murine T-cell lymphoma library that has an open reading frame encoding 381 amino acids. The predicted protein (termed SLY) contains a Src homology 3 domain and a sterile alpha motif, suggesting that

Rescue of Sly Expression Is Not Sufficient to Rescue Spermiogenic Phenotype of Mice with Deletions of Y Chromosome Long Arm.

Jonathan M Riel et al.

Genes, 10(2) (2019-02-15)

Mice with deletions of the Y-specific (non-PAR) region of the mouse Y chromosome long arm (NPYq) have sperm defects and fertility problems that increase proportionally to deletion size. Mice with abrogated function of NPYq-encoded gene Sly (sh367 Sly-KD) display a

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica