Principaux documents

Voir toute la documentation

Passer à

HPA006366

Anti-POLRMT antibody produced in rabbit

Name: Anti-POLRMT antibody produced in rabbit
Brand: SIGMA
Price: 564 EUR

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-DNA-directed RNA polymerase, mitochondrial precursor antibody produced in rabbit, Anti-MtRPOL antibody produced in rabbit

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

À vous/Référence	Disponibilité	Prix
100 μL	Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.	564,00 €

A propos de cet article

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA006366

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

564,00 €

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Service technique

Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.

Laissez-nous vous aider

Propriétés

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH

UniProt accession no.

O00411

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POLRMT(5442)

Description

General description

POLRMT (polymerase (RNA) mitochondrial) gene is located on human chromosome 19p13.3, which codes for a protein of 1230 amino acids. This protein is composed of a unique pentatricopeptide repeat (PPR) domain, a catalytic domain at its C-terminal, and a N-terminal that is similar to the promoter-binding domain of T7 POLRMT.

Immunogen

DNA-directed RNA polymerase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-POLRMT antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

POLRMT (polymerase (RNA) mitochondrial) is involved in the replication of mitochondrial DNA where it acts as an RNA primase. It is also involved in the transcription of 13 subunits of oxidative phosphorylation (OXPHOS) complexes. It is a part of RNA transcription where it needs the aid of B2M (β-2-microglobulin) and transcription factor AM (active motif).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST86643

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 1

Cet article	HPA000827	HPA001915	HPA000264
Sigma-Aldrich HPA006366 Anti-POLRMT antibody produced in rabbit	Sigma-Aldrich HPA000827 Anti-POLR2F antibody produced in rabbit	Sigma-Aldrich HPA001915 Anti-TOP1MT antibody produced in rabbit	Sigma-Aldrich HPA000264 Anti-ETV6 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
UniProt accession no. O00411	UniProt accession no. P61218	UniProt accession no. Q969P6	UniProt accession no. P41212

Still not finding the right product?

Essayez notre Outil de sélection de produits pour affiner vos choix.

Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c