The product is a polyclonal antibody and binding sites are not determined. However, the immunogen sequence is as shown below.
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
HPA008246
Anti-MUC5B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Promotion Available
Enhanced Validation
Synonym(s):
Anti-Cervical mucin, Anti-High molecular weight salivary mucin MG1, Anti-MUC-5B, Anti-Mucin-5 subtype B, tracheobronchial, Anti-Mucin-5B precursor, Anti-Sublingual gland mucin
Sign In to View Organizational & Contract Pricing.
Save 20% off list price*
Use code ATLAS20 in cart. Sign in to check eligibility. Shop Products
Select a Size
Change View
| Size/SKU | Availability | Price |
|---|---|---|
100 μL | Check Cart for Availability | $607.00 |
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
35
$607.00
Save 20% with code ATLAS20Web-Only Discount
Check Cart for Availability
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000
immunogen sequence
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MUC5B(727897)
General description
Mucin 5B (MUC5B) gene is mapped to human chromosome 11p15.5. It codes for a 3570 amino acid peptide characterized with a Cys-subdomains of 108 amino acids.
Immunogen
Mucin-5B precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Mucin 5B (MUC5B) plays a vital role in maintaining immune homeostasis in the lungs by facilitating mucociliary clearance (MCC). Mucins are the key components that imparts gel-like properties to the mucus.(7) Mutation in the gene leads to the development of idiopathic pulmonary fibrosis. Upregulated expression of MUC5B in the ear causes middle ear effusions.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70004
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
This Item | |||
|---|---|---|---|
| description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description clone 8C11, ascites fluid | description clone 15.5B, Chemicon®, from mouse | description clone 19.4E, Chemicon®, from mouse |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form ascites fluid | antibody form purified immunoglobulin | antibody form purified immunoglobulin |
| biological source rabbit | biological source mouse | biological source mouse | biological source mouse |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line - | product line - |
| species reactivity human | species reactivity human | species reactivity - | species reactivity monkey, human |
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
WGK
WGK 1
PPE (personal protective equipment)
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
Hi what is the binding site to MUC5B of the HPA008246 antibody? thank you
1 answer-
Helpful?
-