HPA008406

Anti-QPCT antibody produced in rabbit

Name: Anti-QPCT antibody produced in rabbit
Brand: SIGMA
Price: 7130 SEK

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Glutaminyl cyclase, Anti-Glutaminyl-peptide cyclotransferase precursor, Anti-Glutaminyl-tRNA cyclotransferase, Anti-Glutamyl cyclase, Anti-QC

Slide 1 of 5

Select a Size

100 μL

7 130,00 kr

Please contact Customer Service for Availability

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA008406

Key Documents

View All Documentation

Product Name

Anti-QPCT antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH

UniProt accession no.

Q16769

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA030052	HPA026506	HPA040797
Sigma-Aldrich HPA008406 Anti-QPCT antibody produced in rabbit	Sigma-Aldrich HPA030052 Anti-EPRS antibody produced in rabbit	Sigma-Aldrich HPA026506 Anti-DARS2 antibody produced in rabbit	Sigma-Aldrich HPA040797 Anti-QPCTL antibody produced in rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50	technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

Biochem/physiol Actions

Glutaminyl-peptide cyclotransferase (QPCT) catalyzes the N-terminal pyroglutamate (pGlu) formation from glutaminyl residues. This process which occurs for many bioactive peptides, hormones and chemokines, protects them from degradation.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

Glutaminyl-peptide cyclotransferase (QPCT) is an enzyme localized in the mammalian brain. The gene encoding it is present on the chromosome 2p22.2.

Immunogen

Glutaminyl-peptide cyclotransferase precursor recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST71265

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

A89702

R02347

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding.

Kai-Fa Huang et al.

The Journal of biological chemistry, 286(14), 12439-12449 (2011-02-04)

Aberrant pyroglutamate formation at the N terminus of certain peptides and proteins, catalyzed by glutaminyl cyclases (QCs), is linked to some pathological conditions, such as Alzheimer disease. Recently, a glutaminyl cyclase (QC) inhibitor, PBD150, was shown to be able to

Identification and Epigenetic Analysis of a Maternally Imprinted Gene Qpct.

Jing Guo et al.

Molecules and cells, 38(10), 859-865 (2015-10-09)

Most imprinted genes are concerned with embryonic development, especially placental development. Here, we identified a placenta-specific imprinted gene Qpct. Our results show that Qpct is widely expressed during early embryonic development and can be detected in the telecephalon, midbrain, and

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service