Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

HPA009656

Anti-ZNF174 antibody produced in rabbit

Name: Anti-ZNF174 antibody produced in rabbit
Brand: SIGMA
Price: 564 EUR

Verbesserte Validierung

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-AW-1 antibody produced in rabbit, Anti-Zinc finger and SCAN domain-containing protein 8 antibody produced in rabbit, Anti-Zinc finger protein 174 antibody produced in rabbit

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

Ansicht ändern

Ihnen/SKU	Verfügbarkeit	Preis
100 μL	Warenkorb auf Verfügbarkeit prüfen	564,00 €

Über diesen Artikel

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA009656

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

564,00 €

Warenkorb auf Verfügbarkeit prüfen

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Eigenschaften

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQ

UniProt accession no.

Q15697

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNF174(7727)

Beschreibung

General description

ZNF174 (zinc finger protein 174) is a DNA-binding protein, which contains a conserved region of 84 amino acids called SCAN (SRE-ZBP, CTfin51, AW-1, and Number 18 cDNA) domain. This domain exists as a homodimer. It is composed of three C2H2-type zinc-fingers. This gene is localized to human chromosome 16p13.3.

Immunogen

Zinc finger protein 174 recombinant protein epitope signature tag (PrEST)

Application

Anti-ZNF174 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ZNF174 (zinc finger protein 174) fusion with the DNA-binding domain of yeast GAL4 (galactose-responsive transcription factor) protein might exhibits repression activity on the heterologous DNA-binding domain. It is also responsible for the suppression of platelet-derived growth factor β chain and transforming growth factor-β1 promoters.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST86810

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 1

Dieser Artikel	HPA029553	HPA003354	HPA049863
Sigma-Aldrich HPA009656 Anti-ZNF174 antibody produced in rabbit	Sigma-Aldrich HPA029553 Anti-ZNF114 antibody produced in rabbit	Sigma-Aldrich HPA003354 Anti-ZNF74 antibody produced in rabbit	Sigma-Aldrich HPA049863 Anti-ZNF14 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Probieren Sie unser Produkt-Auswahlhilfe, um Ihre Auswahl einzugrenzen

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c