Key Documents

View All Documentation

Anti-COL6A3 antibody produced in rabbit

Name: Anti-COL6A3 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Enhanced Validation

Synonym(s):

Anti-Collagen α-3(VI) chain precursor antibody produced in rabbit

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA010080

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT

UniProt accession no.

P12111

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... COL6A3(1293)

Description

General description

COL6A3 (collagen type VI a3) is the a subunit of the fibrotic extracellular matrix protein called collagen. In muscles, it is one of the most abundant collagen expressed. This gene is localized to human chromosome 2q37.

Immunogen

Collagen α-3(VI) chain precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-COL6A3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Studies in rodents show that the expression of COL6A3 (collagen type VI α3) is negatively regulated by leptin treatment. Its expression in human adipose tissue is also regulated by leptin, and its expression is decreased in obesity. In humans, its expression is linked with BMI (body mass index) and fat mass. The expression of COL6A3 is similar in patients with obesity and T2DM (type 2 diabtese mellitus), and it regulates adopose tissue macrophage chemotaxis and inflammation. Its expression is also linked with weight gain. The expression of this protein in adipocytes is linked with insulin resistance, which is thought to be dependent on PPAR (peroxisome proliferator-activated receptor) α-mediated adipocyte development.
Mutations in this gene are linked with both mild and server forms of Ullrich congenital muscular dystrophy. Mutations in this gene are also linked with Bethlem myopathy, which is an autosomal dominant disorder.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST86862

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA007583	HPA019142	HPA011795
Sigma-Aldrich HPA010080 Anti-COL6A3 antibody produced in rabbit	Sigma-Aldrich HPA007583 Anti-COL3A1 antibody produced in rabbit	Sigma-Aldrich HPA019142 Anti-COL6A1 antibody produced in rabbit	Sigma-Aldrich HPA011795 Anti-COL1A1 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
Gene Information human ... COL6A3(1293)	Gene Information human ... COL3A1(1281)	Gene Information human ... COL6A1(1291)	Gene Information human ... COL1A1(1277)

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.