Key Documents

Anti-GLG1 antibody produced in rabbit

Name: Anti-GLG1 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CFR-1 antibody produced in rabbit, Anti-Cysteine-rich fibroblast growth factor receptor antibody produced in rabbit, Anti-E-selectin ligand 1 antibody produced in rabbit, Anti-ESL-1 antibody produced in rabbit, Anti-Golgi apparatus protein 1 precursor antibody produced in rabbit, Anti-Golgi sialoglycoprotein MG-160 antibody produced in rabbit

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA010815

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY

UniProt accession no.

Q92896

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GLG1(2734)

Description

General description

GLG1 (golgi glycoprotein 1) is a type I transmembrane sialoglycoprotein, which is rich in cysteine residues. It is localized to the Golgi bodies, in the medial cisternae. This gene is located on human chromosome 16q22-q23. It is an FGF (fibroblast growth factor)-binding protein, independent of tyrosine kinase. It has a unique CFR (cysteine-rich fibroblast growth factor receptor) motif, of which 16 repeats are present in the extracellular domain. Its transmembrane domain consists of 21 amino acids, and its cytoplasmic domain has only 13 amino acids. Due to alternative splicing, a different isoform of GLG1 has an additional 24 amino acids in the cytoplasmic domain. This isoform is located in the Golgi apparatus, whereas the isoform with the shorter cytoplasmic tail is localized to the cell surface. It is ubiquitously expressed from an early embryonic stage to adulthood.

Immunogen

Golgi apparatus protein 1 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-GLG1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

GLG1 (golgi glycoprotein 1) binds to FGF (fibroblast growth factor), as well as to E-selectin and TGFβ (transforming growth factor β). It regulates the function of TGFβ, by modulating its maturation and secretion. This protein interacts with FGF18 at the cell surface, and positively regulates the FGF18 signaling cascade. GLG1 might act as a chaperone protein by regulating the processing and targeting of basic fibroblast growth factor (bFGF), in the cell. This protein is also associated with malignant astrocytomas in humans, and might have a role in the malignancy of these tumors. It is suggested that GLG1 aids in binding of E-selectin to myeloid cells. It might also play a role in the initiation of leukocyte endothelial contact formation, as it is expressed in microvilli of leukocytes.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71695

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	SAB1303679	HPA060392	HPA030497
Sigma-Aldrich HPA010815 Anti-GLG1 antibody produced in rabbit	$ANTI-GLG1 (C-TERM) antibody produced in rabbit IgG fraction of antiserum, buffered aqueous solution$ Sigma-Aldrich SAB1303679 ANTI-GLG1 (C-TERM) antibody produced in rabbit	Sigma-Aldrich HPA060392 Anti-ALG1 antibody produced in rabbit	Sigma-Aldrich HPA030497 Anti-GYG1 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description IgG fraction of antiserum, buffered aqueous solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
antibody form affinity isolated antibody	antibody form IgG fraction of antiserum	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500	technique(s) immunohistochemistry: 1:50-1:100, western blot: 1:1000	technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.