Documenti fondamentali

Visualizza tutta la documentazione

Vai a

HPA011069

Anti-MANEA antibody produced in rabbit

Name: Anti-MANEA antibody produced in rabbit
Brand: SIGMA
Price: 564 EUR

Convalida avanzata

Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Endo-α mannosidase, Anti-Endomannosidase, Anti-Glycoprotein endo-α-1,2-mannosidase, Anti-Mandaselin, Anti-hEndo

per visualizzare i prezzi organizzativi e contrattuali.

Scegli un formato

Cambia visualizzazione

A voi/SKU	Disponibilità	Prezzo
100 μL	Per informazioni sulla disponibilità, contatta il Servizio Clienti.	564,00 €

Informazioni su questo articolo

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA011069

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

564,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Servizio Tecnico

Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.

Permettici di aiutarti

Proprietà

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYT

UniProt accession no.

Q5SRI9

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MANEA(79694)

Descrizione

General description

MANEA (mannosidase, endo-α) is a type II transmembrane glycosidic protein. This enzyme is made of 462 amino acids and has a molecular weight of 53.6kDa. Its transmembrane region is made of 19 amino acids and lies in close proximity to the N-terminal. This gene is present on human chromosome 6q16.1, and is expressed in multiple human tissues including brain, kidney and liver.

Immunogen

Glycoprotein endo-α-1,2-mannosidase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

MANEA (mannosidase, endo-α) catalyzes the cleavage of mono-, di-, and tri-glucosyl-mannose oligosaccharides from high-mannose N-glycans, by breaking the α-1,2-mannosidic bond. Studies also suggest that MANEA is involved in ensuring proper N-glycosylation, and thus provides cells with the ability to recover and mature glycosylated structures. Single nucleotide polymorphisms (SNPs) in this gene are linked to cocaine dependence and cocaine induced paranoia in European American and African American populations. Studies suggest that variations in MANEA gene are associated with anxiety disorder.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72260

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Confronta articoli simili

Visualizza il confronto per intero

Mostra le differenze

1 of 1

Questo articolo	HPA011046	HPA058185	SAB4500075
Sigma-Aldrich HPA011069 Anti-MANEA antibody produced in rabbit	Sigma-Aldrich HPA011046 Anti-MANEA antibody produced in rabbit	Sigma-Aldrich HPA058185 Anti-MAEA antibody produced in rabbit	Sigma-Aldrich SAB4500075 Anti-MAEA antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C
species reactivity human	species reactivity human	species reactivity human	species reactivity rat, human, mouse

Still not finding the right product?

Explore all of our products under Anti-MANEA antibody produced in rabbit

— o —

Provate il nostro Motore di ricerca dei prodotti per restringere le opzioni.

Classe di stoccaggio

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c