Key Documents

View All Documentation

Anti-TARDBP antibody produced in rabbit

Name: Anti-TARDBP antibody produced in rabbit
Brand: SIGMA
Price: 573 USD
Availability: InStock

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-TAR DNA-binding protein 43, Anti-TDP-43

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$573.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017284

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$573.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN

UniProt accession no.

Q13148

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TARDBP(23435)

Description

General description

TARDBP (TAR DNA binding protein) is a nuclear localized, heterogeneous, highly conserved ribonucleo protein. It is widely expressed in tissues, including heart, lung, liver, spleen, kidney, muscle, and brain. It consists of two RNA-recognition motifs and a glycine-rich C-terminal sequence.

Immunogen

TAR DNA-binding protein 43 recombinant protein epitope signature tag (PrEST)

Application

Anti-TARDBP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TARDBP (TAR DNA binding protein) functions as a transcriptional gene and is involved in various processes such as RNA splicing of the cystic fibrosis transmembrane conductance regulator gene. It has been reported that TARDBP may play an important role in neurodegeneration. Abnormal aggregation of TARDBP causes an adult-onset neurological disorder, amyotrophic lateral sclerosis (ALS), that leads to the degeneration of motor neurons.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71040

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	WH0023435M1	T1705	AV38941
Sigma-Aldrich HPA017284 Anti-TARDBP antibody produced in rabbit	Sigma-Aldrich WH0023435M1 Monoclonal Anti-TARDBP antibody produced in mouse	Sigma-Aldrich T1705 Anti-TDP-43 antibody produced in rabbit	$Anti-TARDBP (AB1) antibody produced in rabbit IgG fraction of antiserum$ Sigma-Aldrich AV38941 Anti-TARDBP (AB1) antibody produced in rabbit
description affinity isolated antibody, buffered aqueous glycerol solution	description clone 2E2-D3, purified immunoglobulin, buffered aqueous solution	description ~1.5 mg/mL, affinity isolated antibody, buffered aqueous solution	description IgG fraction of antiserum
biological source rabbit	biological source mouse	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 200	Quality Level 100
antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form IgG fraction of antiserum
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
technique(s) immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500	technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, immunoprecipitation (IP): suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL	technique(s) indirect immunofluorescence: 5-10 μg/mL using human HepG2 cells, immunohistochemistry: 5-10 μg/mL using rat, mouse or human kidney, western blot: 1.5-3.0 μg/mL using human U2OS cell lysates	technique(s) immunohistochemistry: suitable, western blot: suitable
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.