Key Documents

View All Documentation

Anti-TOX4 antibody produced in rabbit

Name: Anti-TOX4 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

affinity isolated antibody, buffered aqueous glycerol solution

Promotion Available

Synonym(s):

Anti-Epidermal Langerhans cell protein LCP1, Anti-TOX high mobility group box family member 4

Save 20% off list price*

Use code ATLAS20 in cart. Sign in to check eligibility. Shop Products

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017880

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Save 20% with code ATLAS20

Web-Only Discount

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS

UniProt accession no.

O94842

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TOX4(9878)

Description

General description

TOX high mobility group box family member 4 (TOX4) belongs to the HMG-box protein family and is expressed in the nucleus. It possesses lysine-based NLS (nuclear localization signal) and DNA-binding HMG box motif.

Immunogen

TOX high mobility group box family member 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-TOX4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-TOX4 antibody produced in rabbit has been used for epifluorescence microscopy.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

TOX high mobility group box family member 4 (TOX4) recognizes DNA adducts which are produced by platinum anticancer drugs and is suggested to be involved in cellular mechanisms against DNA damage. The carboxyl-terminal of TOX4 interacts with the amino-terminal region of protein phosphatase-1 nuclear targeting subunit (PNUTS) and this complex may play a role in the transcriptional regulation of genes. TOX4 also interacts with lens epithelium derived growth factor (LEDGF).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70391

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA027551	HPA029901	SAB2108306
Sigma-Aldrich HPA017880 Anti-TOX4 antibody produced in rabbit	Sigma-Aldrich HPA027551 Anti-TOX4 antibody produced in rabbit	Sigma-Aldrich HPA029901 Anti-SOX4 antibody produced in rabbit	Sigma-Aldrich SAB2108306 Anti-SOX4 antibody produced in rabbit
description affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous solution
shipped in wet ice	shipped in wet ice	shipped in wet ice	shipped in wet ice

Still not finding the right product?

Explore all of our products under Anti-TOX4 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

A106383

R07887

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.