Key Documents

View All Documentation

Anti-POLDIP3 antibody produced in rabbit

Name: Anti-POLDIP3 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-46 kDa DNA polymerase delta interaction protein, Anti-Polymerase delta-interacting protein 3, Anti-p46

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA018419

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR

UniProt accession no.

Q9BY77

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POLDIP3(84271)

Description

General description

The gene POLDIP3 (polymerase δ-interacting protein 3) is mapped to human chromosome 22q13.2. It is also popularly referred as SKAR. POLDIP3 is expressed ubiquitously, with highest levels in brain, heart, skeletal muscle, and kidney. The protein is mainly localized in the nucleus and exhibit a punctuate pattern. However, POLDIP3 can shuttle between the nucleus and the cytoplasm.

Immunogen

Polymerase delta-interacting protein 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Polymerase δ-interacting protein 3 (POLDIP3) is deposited at the exon-junction complex and recruits S6K1 (ribosomal protein S6 kinase β-1) to the mRNA. POLDIP3 and S6K1 together are important to increase the translation efficiency of spliced mRNA. S6K1 lies downstream of mTOR (mammalian target of rapamycin) and PI3K (phosphoinositides 3-kinase), which are involved in cell growth promotion and cell cycle progression. Absence of S6K1 or S6K1 interacting partner POLDIP3 decreases cell size. IFN-α (interferon-α) induces phosphorylation of POLDIP3, thereby enhancing latter interaction with the eukaryotic initiation factor 4G. This pathway is important for regulation of mRNA translation of IFN-sensitive genes and induction of IFN-α biological response. POLDIP3 also interacts with the p50 subunit of DNA polymerase δ and enhancer of rudimentary protein.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74560

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA048790	HPA079430	HPA040796
Sigma-Aldrich HPA018419 Anti-POLDIP3 antibody produced in rabbit	Sigma-Aldrich HPA048790 Anti-POLDIP3 antibody produced in rabbit	Sigma-Aldrich HPA079430 Anti-CLIP3 antibody produced in rabbit	Sigma-Aldrich HPA040796 Anti-TRAF3IP3 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunohistochemistry: 1:20-1:50, immunofluorescence: 0.25-2 μg/mL, immunoblotting: 0.04-0.4 μg/mL	technique(s) immunohistochemistry: 1:1000-1:2500, immunofluorescence: 0.25-2 μg/mL	technique(s) immunofluorescence: 0.25-2 μg/mL (ICC-IF), immunohistochemistry: 1:50 - 1:200	technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

Still not finding the right product?

Explore all of our products under Anti-POLDIP3 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.