Select a Size
| Size/SKU | Availability | Price |
|---|---|---|
100 μL | Check Cart for Availability | $607.00 |
About This Item
$607.00
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous glycerol solution
species reactivity
mouse, human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: 0.04-0.4 μg/mL
immunogen sequence
CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GNB2L1(10399)
General description
Immunogen
Application
Biochem/physiol Actions
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Other Notes
Legal Information
Disclaimer
1 of 1
This Item | |||
|---|---|---|---|
| description affinity isolated antibody, buffered aqueous glycerol solution | description IgG fraction of antiserum, buffered aqueous solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2 |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| antibody form affinity isolated antibody | antibody form IgG fraction of antiserum | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| Gene Information human ... GNB2L1(10399) | Gene Information human ... GNB2L1(10399) | Gene Information human ... RIPK1(8737) | Gene Information human ... CDK5RAP3(80279) |
| technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: 0.04-0.4 μg/mL | technique(s) western blot: 1:500-1:1,000 using HEK-293T cell lystes, indirect immunofluorescence: 1:100-1:200 using paraformaldehyde-fixed HeLa cells, immunoprecipitation (IP): 5-10 μL using HEK-293T cell lysates | technique(s) immunohistochemistry: 1:50-1:200, immunofluorescence: 0.25-2 μg/mL, immunoblotting: 0.04-0.4 μg/mL | technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200 |
| form buffered aqueous glycerol solution | form buffered aqueous solution | form buffered aqueous glycerol solution | form buffered aqueous glycerol solution |
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.



