Key Documents

Anti-RACK1 antibody produced in rabbit

Name: Anti-RACK1 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Cell proliferation-inducing gene 21 protein, Anti-Guanine nucleotide-binding protein subunit beta-2-like 1, Anti-Guanine nucleotide-binding protein subunit beta-like protein 12.3, Anti-HLC-7, Anti-RACK1, Anti-Receptor for activated C kinase, Anti-Receptor of activated protein kinase C 1

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA021676

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC (p), WB

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

mouse, human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: 0.04-0.4 μg/mL

immunogen sequence

CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GNB2L1(10399)

Description

General description

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.

Immunogen

Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-GNB2L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been predicted that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein (MDR3/ABCB4) and is vital for the plasma membrane localization and translocation function of ABCB4.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74729

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	R1905	HPA015257	HPA022882
Sigma-Aldrich HPA021676 Anti-RACK1 antibody produced in rabbit	$Anti-RACK1 (N-terminal) antibody produced in rabbit IgG fraction of antiserum, buffered aqueous solution$ Sigma-Aldrich R1905 Anti-RACK1 (N-terminal) antibody produced in rabbit	Sigma-Aldrich HPA015257 Anti-RIPK1 antibody produced in rabbit	Sigma-Aldrich HPA022882 Anti-CDK5RAP3 antibody produced in rabbit
description affinity isolated antibody, buffered aqueous glycerol solution	description IgG fraction of antiserum, buffered aqueous solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form IgG fraction of antiserum	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Gene Information human ... GNB2L1(10399)	Gene Information human ... GNB2L1(10399) mouse ... Gnb2l1(14694) rat ... Gnb2l1(83427)	Gene Information human ... RIPK1(8737)	Gene Information human ... CDK5RAP3(80279)
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: 0.04-0.4 μg/mL	technique(s) western blot: 1:500-1:1,000 using HEK-293T cell lystes, indirect immunofluorescence: 1:100-1:200 using paraformaldehyde-fixed HeLa cells, immunoprecipitation (IP): 5-10 μL using HEK-293T cell lysates	technique(s) immunohistochemistry: 1:50-1:200, immunofluorescence: 0.25-2 μg/mL, immunoblotting: 0.04-0.4 μg/mL	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200
form buffered aqueous glycerol solution	form buffered aqueous solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.