Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

HPA024372

Anti-S100A8 antibody produced in rabbit

Name: Anti-S100A8 antibody produced in rabbit
Brand: SIGMA
Price: 455 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-CFAG, Anti-Calgranulin-A, Anti-Calprotectin L1L subunit, Anti-Cystic fibrosis antigen, Anti-Leukocyte L1 complex light chain, Anti-MRP-8, Anti-Migration inhibitory factor-related protein 8, Anti-P8, Anti-Protein S100-A8, Anti-S100 calcium-binding protein A8

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

Ansicht ändern

Packungsgröße	SKU	Verfügbarkeit	Preis
100 μL		Warenkorb auf Verfügbarkeit prüfen	CHF 455.00

Über diesen Artikel

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA024372

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

CHF 455.00

Warenkorb auf Verfügbarkeit prüfen

Für Ihr Target ist ein rekombinanter, konservierungsmittelfreier Antikörper verfügbar. Probieren Sie ZRB1672

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Eigenschaften

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:2500-1:5000

immunogen sequence

LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM

UniProt accession no.

P05109

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... S100A8(6279)

Beschreibung

General description

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer (S100A8/A9). The protein has two EF-hand motifs and one high-affinity Ca²⁺ binding site. S100A8 is also referred to as myeloid-related protein 8 (MRP8) or calgranulin A.

Immunogen

Protein S100-A8 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-S100A8 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.[1][2]

Biochem/physiol Actions

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is required for sending neutrophils to the site of inflammation in presence of bacterial infection, lipopolysaccharide, and monosodium urate crystals. It is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In presence of falciparum malaria, high levels of S100A8 are present in the blood.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70709

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 1

Dieser Artikel	HPA004193	HPA003340	HPA006997
Sigma-Aldrich HPA024372 Anti-S100A8 antibody produced in rabbit	Sigma-Aldrich HPA004193 Anti-S100A9 antibody produced in rabbit	Sigma-Aldrich HPA003340 Anti-S100A10 antibody produced in rabbit	Sigma-Aldrich HPA006997 Anti-S100A7 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Probieren Sie unser Produkt-Auswahlhilfe, um Ihre Auswahl einzugrenzen

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Suche nach COA

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Global Trade Item Number

SKU	GTIN
HPA024372-100UL	04061837127120
HPA024372-25UL	04061842844807

Questions

Reviews

No rating value