Key Documents

View All Documentation

Anti-CDNF antibody produced in rabbit

Name: Anti-CDNF antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Armetl1, Anti-Cerebral dopamine neurotrophic factor

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA044587

eCl@ss:

32160702

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH

UniProt accession no.

Q49AH0

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDNF(441549)

Description

General description

The cerebral dopamine neurotrophic factor (CDNF) gene, with 4 exons spanning 18,732bp of genomic DNA, is mapped to human chromosome 10p13. The gene codes for a member of neurotrophic family. CDNF is expressed in several brain regions, including both the striatum and ventral tegmental area (VTA).

Immunogen

cerebral dopamine neurotrophic factor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Cerebral dopamine neurotrophic factor (CDNF) exhibits neurotrophic, neuroprotective and neurorestorative activities. In addition, it also stimulates the survival, growth and function of dopamine-specific neurons. Genetic variation in the gene might increase the risk of susceptibility to Parkinson disease (PD). Additionally, mutation in the gene might also lead to neuroplasticity changes in mesocorticolimbic dopamine system and increase risk of susceptibility to cocaine dependence.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST80389

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	P1374	PRS4343	SAB2109185
Sigma-Aldrich HPA044587 Anti-CDNF antibody produced in rabbit	Sigma-Aldrich P1374 Anti-Pro-BDNF antibody produced in rabbit	Sigma-Aldrich PRS4343 Anti-CDNF (ab1) antibody produced in rabbit	Sigma-Aldrich SAB2109185 Anti-CDNF (N-terminal) antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description affinity isolated antibody, lyophilized powder	description affinity isolated antibody, buffered aqueous solution	description affinity isolated antibody
Quality Level 100	Quality Level 200	Quality Level 100	Quality Level -
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -	product line -
Gene Information human ... CDNF(441549)	Gene Information human ... BDNF(627) mouse ... Bdnf(12064) rat ... Bdnf(24225)	Gene Information human ... ARMETL1(441549)	Gene Information human ... CDNF(57396)

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.