Key Documents

View All Documentation

Monoclonal Anti-PCNA antibody produced in mouse

Name: Monoclonal Anti-PCNA antibody produced in mouse
Brand: SIGMA
Price: 580 USD
Availability: InStock

clone 1G7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-MGC8367, Anti-proliferating cell nuclear antigen

Select a Size

Change View

Size/SKU	Availability	Price
100 μg	Estimated to ship TODAYfromSAINT LOUIS	$580.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

MDL number:

MFCD00213036

Conjugate:

unconjugated

Clone:

1G7, monoclonal

Application:

ELISA (i), IF, IP, WB

Citations:

$580.00

Estimated to ship TODAYDetails

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

mouse

Quality Segment

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1G7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

BC000491

UniProt accession no.

P12004

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCNA(5111)

Description

General description

Proliferating cell nuclear antigen (PCNA) is a ring-shaped homotrimer protein that is located at the center of the faithful duplication of eukaryotic genomes. Since it encircles the DNA, PCNA is also known as a sliding clamp. This gene is mapped to human chromosome 20p12.3.

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. (provided by RefSeq)

Immunogen

PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Application

Monoclonal Anti-PCNA antibody has been used in immunocytochemistry and western blotting.

Biochem/physiol Actions

Proliferating cell nuclear antigen (PCNA) controls the production of the leading and lagging strands, that are required for the duplication of DNA. It acts as a cell cycle regulatory protein. This protein regulates apoptosis. PCNA is also involved in non-replicative DNA synthesis events.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	SAB1404178	SAB2502098	HPA030522
Sigma-Aldrich WH0005111M2 Monoclonal Anti-PCNA antibody produced in mouse	Sigma-Aldrich SAB1404178 Monoclonal Anti-PCNA antibody produced in mouse	Sigma-Aldrich SAB2502098 Anti-PCNA antibody produced in goat	Sigma-Aldrich HPA030522 Anti-PCNA antibody produced in rabbit
description clone 1G7, purified immunoglobulin, buffered aqueous solution	description clone S1, purified immunoglobulin, buffered aqueous solution	description affinity isolated antibody, buffered aqueous solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2
clone 1G7, monoclonal	clone S1, monoclonal	clone polyclonal	clone polyclonal
biological source mouse	biological source mouse	biological source goat	biological source rabbit
antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Gene Information human ... PCNA(5111)	Gene Information human ... PCNA(5111)	Gene Information human ... PCNA(5111)	Gene Information human ... PCNA(5111)
species reactivity human	species reactivity human	species reactivity bovine, canine, mouse, pig, human, rat	species reactivity human

Still not finding the right product?

Explore all of our products under Monoclonal Anti-PCNA antibody produced in mouse

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.