Key Documents

Monoclonal Anti-CLEC4M antibody produced in mouse

Name: Monoclonal Anti-CLEC4M antibody produced in mouse
Brand: SIGMA
Price: 580 USD
Availability: InStock

clone 2G1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-C-type lectin domain family 4, member M, Anti-CD209L, Anti-CD299, Anti-DCSIGN2, Anti-DCSIGNR, Anti-HP10347, Anti-LSIGN, Anti-MGC129964, Anti-MGC47866

Select a Size

Change View

Size/SKU	Availability	Price
100 μg	Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$580.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

MDL number:

MFCD03701938

Conjugate:

unconjugated

Clone:

2G1, monoclonal

Application:

ELISA (i), WB

Citations:

$580.00

Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

mouse

Quality Segment

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable, western blot: 1-5 μg/mL

isotype

IgG3λ

GenBank accession no.

NM_014257

UniProt accession no.

Q9H2X3

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLEC4M(10332)

Description

General description

This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants

Immunogen

CLEC4M (NP_055072, 285 a.a. ~ 394 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA042661	HPA004906	WH0029121M1
Sigma-Aldrich WH0010332M1 Monoclonal Anti-CLEC4M antibody produced in mouse	Sigma-Aldrich HPA042661 Anti-CLEC4M antibody produced in rabbit	Sigma-Aldrich HPA004906 Anti-CLEC4D antibody produced in rabbit	Sigma-Aldrich WH0029121M1 Monoclonal Anti-CLEC2D antibody produced in mouse
description clone 2G1, purified immunoglobulin, buffered aqueous solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description clone 4C7, purified immunoglobulin, buffered aqueous solution
clone 2G1, monoclonal	clone polyclonal	clone polyclonal	clone 4C7, monoclonal
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
species reactivity human	species reactivity human	species reactivity human	species reactivity human
biological source mouse	biological source rabbit	biological source rabbit	biological source mouse
Gene Information human ... CLEC4M(10332)	Gene Information human ... CLEC4M(10332)	Gene Information human ... CLEC4D(338339)	Gene Information human ... CLEC2D(29121)
antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form purified immunoglobulin

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.