Accéder au contenu

APREST91023

PrEST Antigen PRAM1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonyme(s) :

PML-RAR

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

UNSPSC Code:
12352202
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 28 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PRAM1(84106)

General description

Recombinant protein fragment of Human PRAM1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Other Notes

Corresponding Antibody HPA045236.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC


Classe de stockage

10 - Combustible liquids

Que se passe-t-il ?

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents