Se connecter pour consulter les tarifs organisationnels et contractuels.
Sélectionner une taille de conditionnement
Changer de vue
A propos de cet article
UNSPSC Code:
12352202
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aiderrecombinant
expressed in E. coli
assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 23 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
TRGQTQDHQGAQITATNKKKVSFSSPLILGATIQKKSAGRSRSALKKPQRA
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... MAGEB3(4114)
General description
Recombinant protein fragment of Human MAGEB3 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Blocking agent and positive assay control using corresponding antibodies.
Physical form
Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA072203.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Classe de stockage
10 - Combustible liquids
Que se passe-t-il ?
WGK 2
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.