Documentos clave

Ver Toda la documentación

Saltar a

HPA012723

Anti-TGOLN2 antibody produced in rabbit

Name: Anti-TGOLN2 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Validación mejorada

Sinónimos:

Anti-TGN38 homolog, Anti-TGN46, Anti-TGN48, Anti-Trans-Golgi network integral membrane protein 2 precursor, Anti-Trans-Golgi network protein TGN51

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Talla/SKU	Disponibilidad	Precio
100 μL	Comprobar disponibilidad del carrito	$667.00

Acerca de este artículo

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA012723

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Comprobar disponibilidad del carrito

Servicio técnico

¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.

Permítanos ayudarle

Propiedades

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS

UniProt accession no.

O43493

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TGOLN2(10618)

Descripción

General description

Trans-Golgi network integral membrane protein 2 (TGOLN2) is a heterodimeric type I integral membrane protein. It has a highly conserved N terminus consisting of a signal peptide. The C terminus comprises part of the lumenal domain, a membrane spanning region and a cytoplasmic tail.

Immunogen

Trans-Golgi network integral membrane protein 2 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-TGOLN2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using indirect immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Trans-Golgi network integral membrane protein 2 (TGOLN2) cycles between the trans-golgi network (TGN) and the cell surface via an early endosomal compartment. It participates in the formation of exocytic vesicles at the TGN by functioning as a receptor for complexes of a cytoplasmic protein known as p62 and one GTP-binding protein. TGOLN2 is suggested to couple the segregation of secretory proteins to the budding of exocytic vesicles. The cytosolic domain of TGOLN2 interacts with AP2 (adaptor protein 2) clathrin adaptor complexes and also with F actin binding protein, neurabin.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72068

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 1

Este artículo	HPA012609	WH0010618M2	SAB5701300
Sigma-Aldrich HPA012723 Anti-TGOLN2 antibody produced in rabbit	Sigma-Aldrich HPA012609 Anti-TGOLN2 antibody produced in rabbit	Sigma-Aldrich WH0010618M2 Monoclonal Anti-TGOLN2 antibody produced in mouse	Sigma-Aldrich SAB5701300 Anti-TGN46/TGOLN2 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description clone 2F11, purified immunoglobulin, buffered aqueous solution	description -
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form -
biological source rabbit	biological source rabbit	biological source mouse	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Still not finding the right product?

Explore all of our products under Anti-TGOLN2 antibody produced in rabbit

— o —

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones

Clase de almacenamiento

10 - Combustible liquids

¿Qué está pasando?

WGK 1

Punto de inflamación (°F)

Not applicable

Punto de inflamación (°C)