This antibody is validated for the human muscarinic acetylcholine receptor M1 only. Cross-reactivity with the mouse receptor has not been experimentally confirmed, despite approximately 98% immunogen-sequence identity. The end user would have to determine suitability. Consider mouse-validated antibody SAB4500244.
HPA014101
Anti-CHRM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Enhanced Validation
Synonym(s):
Anti-Muscarinic acetylcholine receptor M1
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Size/SKU | Availability | Price |
|---|---|---|
100 μL | Check Cart for Availability | $607.00 |
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
3
$607.00
Check Cart for Availability
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:1000- 1:2500
immunogen sequence
SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CHRM1(1128)
General description
The gene CHRM1 (cholinergic receptor, muscarinic 1) encodes a muscarinic cholinergic receptor that is the most abundant muscarinic receptor in the CNS (central nervous system). It is predominantly expressed in the neurons. It is a member of the muscarinic acetylcholine receptor family that conatins five subtypes, CHRM1-CHRM5. These subtypes have high homology but differ in signal transduction mediated via G protein-coupled pathways, resulting in varying physiological responses. The subtypes CHRM1, CHRM3, and CHRM5 have affinity for G proteins of the Gq/11 family and CHRM2 and CHRM4 bind to Gi/o-type G proteins. The gene is mapped to human chromosome 11q13.
Immunogen
Muscarinic acetylcholine receptor M1 recombinant protein epitope signature tag (PrEST)
Application
Anti-CHRM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Biochem/physiol Actions
The protein encoded by the gene CHRM1 (cholinergic receptor, muscarinic 1) stimulates intracellular Ca2+ signaling in response to acetylcholine in striatal cells. The expression of this protein is modulated by heterochromatin condensation and any changes in its structure leads to impaired Ca2+ release from ER. The encoded protein enhances phosphatidylinositol (PtdIns) hydrolysis and mobilization of intracellular Ca2+. Both CHRM1 and CHRM2 are involved in regulating cholinergic action on glutamatergic and GABAergic nerve terminals in the stiratum and this system has been associated with HD (Huntington′s disease) pathology.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72768
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
This Item | |||
|---|---|---|---|
| description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description affinity isolated antibody | description Chemicon®, from rabbit | description affinity isolated antibody, lyophilized powder |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 200 |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity purified immunoglobulin | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line - | product line - |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in - |
Still not finding the right product?
Explore all of our products under Anti-CHRM1 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
PPE (personal protective equipment)
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
Does this antibody cross react with mouse chrm1 or only human?
1 answer-
Helpful?
-