Key Documents

View All Documentation

Anti-CLDN7 antibody produced in rabbit

Name: Anti-CLDN7 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Enhanced Validation

Synonym(s):

Anti-CLDN-7, Anti-Claudin-7

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA014703

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS

UniProt accession no.

O95471

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLDN7(1366)

Description

General description

CLDN7 (claudin-7) belongs to the family of tight junction proteins called claudins, which are responsible for the maintenance of epithelial barrier function. This family has at least 24 members, and they are all membrane proteins. It has a short N-terminal facing the cytosol, two extraplasmic domains, and cytosolic C-terminal. Its spans the membrane four times.

Immunogen

Claudin-7 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

CLDN7 (claudin-7) prevents the invasion and migration of human lung cancer cells, and induces apoptosis by activating caspases, post cisplatin treatment of lung cancer cells. It interacts with CD44 and EpCAM, and might form a membrane-anchoring protein complex, which helps it to reside in the plasma membrane. It is up-regulated in colon cancer, where it facilitates tumorigenesis. Its expression is also associated with inflammatory bowel disease (IBD) and colitis-associated cancer. It is either completely inactivated or under-expressed in human breast cancer, and is also linked with relapse of the same. Studies on human breast cancer MCF-7 cell line, show that tumor necrosis factor (TNF)α induces the expression of CLDN7, which leads to accumulation of β-catenin in the cytosol. This way CLDN7 regulates apoptosis of MCF-7 cell line. It is over-expressed in epithelial ovarian cancer, where it might be involved in its invasion.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73174

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	ABT47	SAB4500437	HPA026945
Sigma-Aldrich HPA014703 Anti-CLDN7 antibody produced in rabbit	Sigma-Aldrich ABT47 Anti-Claudin-7 Antibody	Sigma-Aldrich SAB4500437 Anti-Claudin 7 antibody produced in rabbit	Sigma-Aldrich HPA026945 Anti-CLDN12 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description from rabbit, purified by affinity chromatography	description affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies
storage temp. −20°C	storage temp. -	storage temp. −20°C	storage temp. −20°C

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.