Key Documents

View All Documentation

Anti-HACD3 antibody produced in rabbit

Name: Anti-HACD3 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Enhanced Validation

Synonym(s):

Anti-B-ind1, Anti-HSPC121, Anti-PTPLAD1

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA014837

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPLAD1(51495)

Description

General description

HACD3 (3-hydroxyacyl-CoA dehydratase 3) is a multi-pass membrane protein, which shares high homology with p23, a co-chaperone. This protein is composed of 362 amino acids. This gene is localized to human chromosome 15q22.3. It was originally identified as a gene activated by sodium butyrate. It has a molecular weight of 70.6kDa, and the mRNA is highly expressed in brain, kidney, and liver, and has low expression in skeletal muscle. The protein is ubiquitously expressed.

Immunogen

3-hydroxyacyl-CoA dehydratase 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

HACD3 (3-hydroxyacyl-CoA dehydratase 3) controls gene expression through Rac-1 signaling pathway. It is involved in the replication of hepatitis C virus (HCV), by interacting with HCV nonstructural protein 5A (NS5A), and recruiting heat shock protein 90 (Hsp90) and FK506-binding protein 8 (FKBP8) to the replication complex. This protein is involved in erythropoiesis, in bone marrow, and activation of NF-κB and c-Jun N-terminal kinase, via Rac-1 pathway. It might be involved in the synthesis of very long chain fatty acids, by interacting with ELOVL1, ELOVL5, or ELOVL6.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73204

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA060347	HPA046071	HPA035496
Sigma-Aldrich HPA014837 Anti-HACD3 antibody produced in rabbit	Sigma-Aldrich HPA060347 Anti-HACD3 antibody produced in rabbit	Sigma-Aldrich HPA046071 Anti-HACE1 antibody produced in rabbit	Sigma-Aldrich HPA035496 Anti-HACL1 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
Gene Information human ... PTPLAD1(51495)	Gene Information human ... HACD3(51495)	Gene Information human ... HACE1(57531)	Gene Information human ... HACL1(26061)

Still not finding the right product?

Explore all of our products under Anti-HACD3 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.