Key Documents

View All Documentation

Anti-ACBD3 antibody produced in rabbit

Name: Anti-ACBD3 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Enhanced Validation

Synonym(s):

Anti-Acyl-CoA-binding domain-containing protein 3, Anti-GOCAP1, Anti-GOLPH1, Anti-Golgi complex-associated protein 1, Anti-Golgi phosphoprotein 1, Anti-Golgi resident protein GCP60, Anti-PBR- and PKA-associated protein 7, Anti-Peripheral benzodiazepine receptor-associated protein PAP7

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Estimated to ship onNovember 04, 2026fromSAINT LOUIS	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA015594

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$607.00

Estimated to ship onNovember 04, 2026Details

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT

UniProt accession no.

Q9H3P7

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ACBD3(64746)

Description

General description

Golgi resident protein GCP60 is a protein encoded by the ACBD3 gene in humans. In steroidogenic tissues, it is highly expressed.

Immunogen

Golgi resident protein GCP60 recombinant protein epitope signature tag (PrEST)

Application

Anti-ACBD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ACBD3 interacts with 3A proteins of several picornaviruses, such as PVS2 and CV-A17 at viral RNA replication sites and increases the growth of viruses. The viral protein/ACBD3/PI4KB complex may play an essential role in forming a functional replication complex. Overexpression of this gene inhibits SREBP1-sensitive promoter activity of fatty acid synthase (FASN) and production of nuclear SREBP1. Lipid homeostasis is maintained by ACBD3 through regulating SREBP1′s processing pathway and may have cellular lipogenesis impact. This gene is involved in PRKAR1A-mediated tumorigenesis and hypercortisolism.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72640

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	SAB1405255	SAB6012303	WH0064746M1
Sigma-Aldrich HPA015594 Anti-ACBD3 antibody produced in rabbit	Sigma-Aldrich SAB1405255 Monoclonal Anti-ACBD3 antibody produced in mouse	SAB6012303 KD-Validated Anti ACBD3 Antibody, clone 23GB3620, Rabbit Monoclonal	Sigma-Aldrich WH0064746M1 Monoclonal Anti-ACBD3 antibody produced in mouse
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description clone 2H2, purified immunoglobulin, buffered aqueous solution	description clone 23GB3620, recombinant rabbit monoclonal, expressed in HEK293 cells	description clone 2G2, purified immunoglobulin, buffered aqueous solution
biological source rabbit	biological source mouse	biological source rabbit (Monoclonal)	biological source mouse
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form purified immunoglobulin
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -	product line -
form buffered aqueous glycerol solution	form buffered aqueous solution	form buffered aqueous glycerol solution	form buffered aqueous solution

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.