This is an Anti-PDE6A antibody used to detect phosphodiesterase 6A in research applications such as western blotting and immunohistochemistry. The product is intended for research use only. It is not suitable for therapeutic use.
HPA016970
Anti-PDE6A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Enhanced Validation
Synonym(s):
Anti-PDEA, Anti-RP43
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Size/SKU | Availability | Price |
|---|---|---|
100 μL | Check Cart for Availability | $667.00 |
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
$667.00
Check Cart for Availability
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
independent
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:5000-1:10000
immunogen sequence
TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PDE6A(5145)
General description
PDE6 (phosphodiesterase 6A) is an α-subunit of rod cyclic guanosine monophosphate (cGMP) phosphodiesterase. It is a photoreceptor-specific heterotetrameric protein with two α and β catalytic subunits and two γ-regulatory subunits.
Immunogen
Rod cGMP-specific 3′,5′-cyclic phosphodiesterase subunit alpha recombinant protein epitope signature tag (PrEST)
Application
Anti-PDE6A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
PDE6A (phosphodiesterase 6A) is involved in maintaining the intracellular cGMP levels via visual phototransduction cascade. Mutation in the PDE6A causes an autosomal recessive disorder, retinitis pigmentosa (RP).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70477
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
This Item | |||
|---|---|---|---|
| description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody | description clone 7A11.1, from mouse | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form affinity isolated antibody |
| biological source rabbit | biological source rabbit | biological source mouse | biological source rabbit |
| Quality Level 100 | Quality Level - | Quality Level - | Quality Level 100 |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies |
| technique(s) immunohistochemistry: 1:5000-1:10000, immunoblotting: 0.04-0.4 μg/mL | technique(s) immunohistochemistry: 1:1000-1:2500 | technique(s) western blot: suitable | technique(s) immunohistochemistry: 1:50-1:200, immunofluorescence: 0.25-2 μg/mL |
Still not finding the right product?
Explore all of our products under Anti-PDE6A antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
Hello! what is it? is it eye drops or is it gene therapy for pde6a retinitis pigmentosa?
1 answer-
Helpful?
-