Key Documents

View All Documentation

Anti-ZNF207 antibody produced in rabbit

Name: Anti-ZNF207 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Enhanced Validation

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Zinc finger protein 207

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017013

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

RNAi knockdown
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP

UniProt accession no.

O43670

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNF207(7756)

Description

General description

ZNF207 (zinc finger protein 207) is a microtubule-associated zinc finger protein with molecular mass of 50.7kDa. It is expressed in several human tissues including brain, breast, CNS, colon, foreskin, germ cell, heart, liver, lung, muscle, prostate, tonsil, uterus, and embryo. Structurally, it consists of nearly 20% proline residues a potential nuclear localization signal at the amino terminus and two C₂-H₂ zinc finger motifs.

Immunogen

Zinc finger protein 207 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

ZNF207 (zinc finger protein 207) is involved in the equal chromosome segregation. It mainly binds to the spindle microtubules via its N-terminal domain and regulates chromosome alignment. It also acts as a potential transcription factor with DNA binding capacity. It has been reported that ZNF207 possesses ability to control transcription of β-Gal reporter gene in HeLa cells.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70839

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA063908	HPA042535	HPA027307
Sigma-Aldrich HPA017013 Anti-ZNF207 antibody produced in rabbit	Sigma-Aldrich HPA063908 Anti-ZNF207 antibody produced in rabbit	Sigma-Aldrich HPA042535 Anti-RNF207 antibody produced in rabbit	Sigma-Aldrich HPA027307 Anti-ZNF277 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Still not finding the right product?

Explore all of our products under Anti-ZNF207 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c