HPA019616

Anti-LPAR2 antibody produced in rabbit

Name: Anti-LPAR2 antibody produced in rabbit
Brand: SIGMA

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LPA receptor 2, Anti-LPA-2, Anti-Lysophosphatidic acid receptor 2, Anti-Lysophosphatidic acid receptor Edg-4

Slide 1 of 1

Select a Size

Pricing and availability is not currently available.

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA019616

Key Documents

View All Documentation

Product Name

Anti-LPAR2 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL

UniProt accession no.

Q9HBW0

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA013170	SAB4503572	ABT114
Sigma-Aldrich HPA019616 Anti-LPAR2 antibody produced in rabbit	Sigma-Aldrich HPA013170 Anti-LPAR5 antibody produced in rabbit	Sigma-Aldrich SAB4503572 Anti-EDG4 antibody produced in rabbit	Sigma-Aldrich ABT114 Anti-LPA receptor 5 Antibody (GPR92)
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate -
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -
clone polyclonal	clone polyclonal	clone polyclonal	clone polyclonal

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

LPAR2 (Lysophosphatidic acid receptor 2) is involved in various downstream signaling pathways such as RhoA-ROCK and STAT-3 signaling. It plays a key role in the colorectal cancer (CRC) pathology. In CRC progression it controls cell cycle progression, migration, invasion, and proliferation.[1] During cell migration, it has been reported that cell-cell binding ability depends on the internalization of N-cadherin downstream of lysophosphatidic acid (LPA) receptor 2.[2] LPAR2 is also associated with the receptor-mediated phospholipase C-β3 activation. During activation, C-terminal PDZ domain-binding motif of LPAR2 directly binds to the second PDZ domain of Na(+)/H(+) exchanger regulatory factor2 (NHERF2). Later, that LPAR2 linked PDZ domain of NHERF2 binds to PLC-β3 and forms a complex, which is responsible for gene silencing of PLC-β3.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

LPAR2 (Lysophosphatidic acid receptor 2) is a bioactive lysophospholipid belonging to the endothelial cell differentiation gene (EDG) family of GPCRs. It is widely expressed in different tissues and cell types.[2]

Immunogen

Lysophosphatidic acid receptor 2 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST72734

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

A60111

R08582

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

NHERF2 specifically interacts with LPA2 receptor and defines the specificity and efficiency of receptor-mediated phospholipase C-beta3 activation.

Yong-Seok Oh et al.

Molecular and cellular biology, 24(11), 5069-5079 (2004-05-15)

Lysophosphatidic acid (LPA) activates a family of cognate G protein-coupled receptors and is involved in various pathophysiological processes. However, it is not clearly understood how these LPA receptors are specifically coupled to their downstream signaling molecules. This study found that

Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer.

Shigeru Hashimoto et al.

Nature communications, 7, 10656-10656 (2016-02-09)

Acquisition of mesenchymal properties by cancer cells is critical for their malignant behaviour, but regulators of the mesenchymal molecular machinery and how it is activated remain elusive. Here we show that clear cell renal cell carcinomas (ccRCCs) frequently utilize the

LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways.

Fernanda Leve et al.

PloS one, 10(9), e0139094-e0139094 (2015-09-30)

Lysophosphatidic acid (LPA) plays a critical role in the proliferation and migration of colon cancer cells; however, the downstream signaling events underlying these processes remain poorly characterized. The aim of this study was to investigate the signaling pathways triggered by

In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity.

Sei Kuriyama et al.

The Journal of cell biology, 206(1), 113-127 (2014-07-09)

Collective cell migration (CCM) and epithelial-mesenchymal transition (EMT) are common to cancer and morphogenesis, and are often considered to be mutually exclusive in spite of the fact that many cancer and embryonic cells that have gone through EMT still cooperate

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service