Key Documents

View All Documentation

Anti-LSP1 antibody produced in rabbit

Name: Anti-LSP1 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Enhanced Validation

Synonym(s):

Anti-47 kDa actin-binding protein, Anti-52 kDa phosphoprotein, Anti-Lymphocyte-specific antigen WP34, Anti-Lymphocyte-specific protein 1, Anti-Protein pp52

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

MDL number:

MFCD01633599

Human Protein Atlas Number:

HPA019693

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:1000-1:2500

immunogen sequence

PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK

UniProt accession no.

P33241

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LSP1(4046)

Description

General description

LSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative serine/threonine phosphorylation sites. In addition to these two domains, it has additional Ca2(+)-binding site.

LSP1 gene is mapped to human chromosome 11p15. It has 20 exons.

Immunogen

Lymphocyte-specific protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-LSP1 antibody produced in rabbit has been used in:

immunoprecipitation
western blots
proximity ligation assay (PLA)

Biochem/physiol Actions

LSP1 (Lymphocyte-specific protein 1) is an actin binding protein. It is phosphorylated via MAPKAPK2 (MK2) directed pathway, which further plays a vital role in the F-actin polarization during neutrophil chemotaxis.

LSP1 controls the migration of immune cell in inflammation and phagocytosis. It also modulates cell adhesion.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74191

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA071843	SAB3500953	HPA037704
Sigma-Aldrich HPA019693 Anti-LSP1 antibody produced in rabbit	Sigma-Aldrich HPA071843 Anti-LSP1 antibody produced in rabbit	Sigma-Aldrich SAB3500953 Anti-LSD1 antibody produced in rabbit	Sigma-Aldrich HPA037704 Anti-LSG1 antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies
UniProt accession no. P33241	UniProt accession no. P33241	UniProt accession no. O60341	UniProt accession no. Q9H089

Still not finding the right product?

Explore all of our products under Anti-LSP1 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)